BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10j02 (689 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 25 0.90 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 25 0.90 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 4.8 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 8.4 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 8.4 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 8.4 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 8.4 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 8.4 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 8.4 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 8.4 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 8.4 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 8.4 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 8.4 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 8.4 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 8.4 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 8.4 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 8.4 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 8.4 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 24.6 bits (51), Expect = 0.90 Identities = 17/68 (25%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = -3 Query: 588 NFTLLGSNDTRTVRTNQSRLVLSQEGMFYSH-HIMLWHTFCNAHNEGHFSLNSF*NGCCS 412 NF +LG+N +R ++ +Q+ Y+H H H+ + N+ + N + Sbjct: 397 NFQILGANVNDLIRNSRCANFDNQDNNHYNHNHNQARHS-SKSDNQNNNQHNDQAHHSSK 455 Query: 411 SRGRYINN 388 S R+ NN Sbjct: 456 SNNRHNNN 463 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 24.6 bits (51), Expect = 0.90 Identities = 13/53 (24%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +1 Query: 172 ETRKNLILTSETKVIVQGFTGKQGTFHSQQAL-DYGTKVVGGVSPKKAGTEHL 327 + R L +T ++ + ++ + Q++ DY + + V KKAG++HL Sbjct: 287 DLRSQLEYDLQTSIMSRHYSTRAIVIEKGQSIWDYDSTYIPKVKNKKAGSKHL 339 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.2 bits (45), Expect = 4.8 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 58 RRFTFNNSTMAMPVRVLSKFKDGLKLG 138 R TF + P++ +S KDG LG Sbjct: 323 RPATFTCNVRGNPIKTVSWLKDGKPLG 349 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -1 Query: 347 VPNTGLPRCSVPAFFGDTPPTTLV 276 +P+ + + VP ++G+ PP ++ Sbjct: 82 IPSHYIEQIPVPVYYGNFPPRPIM 105 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -1 Query: 347 VPNTGLPRCSVPAFFGDTPPTTLV 276 +P+ + + VP ++G+ PP ++ Sbjct: 82 IPSHYIEQIPVPVYYGNFPPRPIM 105 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -1 Query: 347 VPNTGLPRCSVPAFFGDTPPTTLV 276 +P+ + + VP ++G+ PP ++ Sbjct: 82 IPSHYIEQIPVPVYYGNFPPRPIM 105 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -1 Query: 347 VPNTGLPRCSVPAFFGDTPPTTLV 276 +P+ + + VP ++G+ PP ++ Sbjct: 82 IPSHYIEQIPVPVYYGNFPPRPIM 105 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -1 Query: 347 VPNTGLPRCSVPAFFGDTPPTTLV 276 +P+ + + VP ++G+ PP ++ Sbjct: 82 IPSHYIEQIPVPVYYGNFPPRPIM 105 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -1 Query: 347 VPNTGLPRCSVPAFFGDTPPTTLV 276 +P+ + + VP ++G+ PP ++ Sbjct: 82 IPSHYIEQIPVPVYYGNFPPRPIM 105 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -1 Query: 347 VPNTGLPRCSVPAFFGDTPPTTLV 276 +P+ + + VP ++G+ PP ++ Sbjct: 82 IPSHYIEQIPVPVYYGNFPPRPIM 105 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -1 Query: 347 VPNTGLPRCSVPAFFGDTPPTTLV 276 +P+ + + VP ++G+ PP ++ Sbjct: 331 IPSHYIEQIPVPVYYGNFPPRPIM 354 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -1 Query: 347 VPNTGLPRCSVPAFFGDTPPTTLV 276 +P+ + + VP ++G+ PP ++ Sbjct: 331 IPSHYIEQIPVPVYYGNFPPRPIM 354 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -1 Query: 347 VPNTGLPRCSVPAFFGDTPPTTLV 276 +P+ + + VP ++G+ PP ++ Sbjct: 331 IPSHYIEQIPVPVYYGNFPPRPIM 354 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -1 Query: 347 VPNTGLPRCSVPAFFGDTPPTTLV 276 +P+ + + VP ++G+ PP ++ Sbjct: 331 IPSHYIEQIPVPVYYGNFPPRPIM 354 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -1 Query: 347 VPNTGLPRCSVPAFFGDTPPTTLV 276 +P+ + + VP ++G+ PP ++ Sbjct: 331 IPSHYIEQIPVPVYYGNFPPRPIM 354 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -1 Query: 347 VPNTGLPRCSVPAFFGDTPPTTLV 276 +P+ + + VP ++G+ PP ++ Sbjct: 331 IPSHYIEQIPVPVYYGNFPPRPIM 354 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -1 Query: 347 VPNTGLPRCSVPAFFGDTPPTTLV 276 +P+ + + VP ++G+ PP ++ Sbjct: 315 IPSHYIEQIPVPVYYGNFPPRPIM 338 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/24 (25%), Positives = 15/24 (62%) Frame = -1 Query: 347 VPNTGLPRCSVPAFFGDTPPTTLV 276 +P+ + + VP ++G+ PP ++ Sbjct: 331 IPSHYIEQIPVPVYYGNFPPRPIM 354 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 198,167 Number of Sequences: 438 Number of extensions: 4346 Number of successful extensions: 22 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -