BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10i12 (535 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 25 0.37 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 23 1.5 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 25.4 bits (53), Expect = 0.37 Identities = 17/85 (20%), Positives = 39/85 (45%) Frame = +3 Query: 96 LRIVAVNKNNNIMDALSTGTLSGAQKEELMDQVKQQIAIANAQELLTKMTEKCFKKCINK 275 L + AV+KN ++ L+ TLS + + +D+ + +A ++ L + K+ + + Sbjct: 305 LTVKAVSKNGVLLFGLANNTLSCWNEHQSLDRQNIDV-VARNEDTLQMVVSMKIKQNVPQ 363 Query: 276 PGTSLDSSEQKCIAMCMDRYMDSWN 350 G ++ + + DR + N Sbjct: 364 SGRVNNTQRNEYLLALSDRNQNVLN 388 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 23.4 bits (48), Expect = 1.5 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +3 Query: 123 NNIMDALSTGTLS 161 NN +DAL TGT+S Sbjct: 471 NNALDALRTGTIS 483 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,611 Number of Sequences: 438 Number of extensions: 2874 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15090993 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -