BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10i12 (535 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g61570.1 68414.m06938 mitochondrial import inner membrane tra... 76 2e-14 At5g50810.1 68418.m06295 mitochondrial import inner membrane tra... 55 3e-08 At2g29530.1 68415.m03587 mitochondrial import inner membrane tra... 37 0.010 At3g46560.1 68416.m05054 mitochondrial import inner membrane tra... 36 0.017 At5g15730.1 68418.m01840 serine/threonine protein kinase, putati... 29 1.9 At2g35075.1 68415.m04303 hypothetical protein 29 2.6 At5g09420.1 68418.m01091 chloroplast outer membrane translocon s... 27 5.9 At5g47990.1 68418.m05929 cytochrome P450 family protein similar ... 27 7.9 >At1g61570.1 68414.m06938 mitochondrial import inner membrane translocase (TIM13) identical to mitochondrial import inner membrane translocase subunit Tim13 [Arabidopsis thaliana] Swiss-Prot:Q9XH48; contains Pfam domain, PF02953: Tim10/DDP family zinc finger Length = 87 Score = 75.8 bits (178), Expect = 2e-14 Identities = 32/72 (44%), Positives = 49/72 (68%) Frame = +3 Query: 150 GTLSGAQKEELMDQVKQQIAIANAQELLTKMTEKCFKKCINKPGTSLDSSEQKCIAMCMD 329 G+ S E +M+ VK Q+A A A+EL+ + KCF KC+ KPG+SL SE CI+ C++ Sbjct: 11 GSGSSVSPEVMMESVKTQLAQAYAEELIETLRTKCFDKCVTKPGSSLGGSESSCISRCVE 70 Query: 330 RYMDSWNLVSRT 365 RYM++ ++SR+ Sbjct: 71 RYMEATAIISRS 82 >At5g50810.1 68418.m06295 mitochondrial import inner membrane translocase (TIM8) identical to mitochondrial import inner membrane translocase subunit Tim8 [Arabidopsis thaliana] Swiss-Prot:Q9XGY4; contains Pfam domain, PF02953: Tim10/DDP family zinc finger Length = 77 Score = 55.2 bits (127), Expect = 3e-08 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 1/74 (1%) Frame = +3 Query: 159 SGAQKEELMDQVKQQIAIANAQELLTKMTEKCFKKCINK-PGTSLDSSEQKCIAMCMDRY 335 S A EL+ + Q+ A E+++KMT C+ KCI PG+ SSE C+ C RY Sbjct: 4 SMANNPELLQFLAQEKERAMVNEMVSKMTSVCWDKCITSAPGSKFSSSESSCLTHCAQRY 63 Query: 336 MDSWNLVSRTYSSR 377 MD ++ + ++S+ Sbjct: 64 MDMSMIIMKRFNSQ 77 >At2g29530.1 68415.m03587 mitochondrial import inner membrane translocase (TIM10) identical to mitochondrial import inner membrane translocase subunit Tim10 [Arabidopsis thaliana] Swiss-Prot:Q9ZW33; contains Pfam domain, PF02953: Tim10/DDP family zinc finger Length = 83 Score = 36.7 bits (81), Expect = 0.010 Identities = 19/73 (26%), Positives = 33/73 (45%), Gaps = 2/73 (2%) Frame = +3 Query: 162 GAQKEELMDQVKQQIAIANAQELLTKMTEKCFKKCINK--PGTSLDSSEQKCIAMCMDRY 335 G KE+ + ++ EL K+ + CF KC++K L+ E CI C+ +Y Sbjct: 8 GVTKEQAFSMAQTEMEYR--VELFNKLAQTCFNKCVDKRYKEAELNMGENSCIDRCVSKY 65 Query: 336 MDSWNLVSRTYSS 374 +V + S+ Sbjct: 66 WQVNGMVGQLLSA 78 >At3g46560.1 68416.m05054 mitochondrial import inner membrane translocase (TIM9) identical to mitochondrial import inner membrane translocase subunit Tim9 [Arabidopsis thaliana] Swiss-Prot:Q9XGX9; contains Pfam domain, PF02953: Tim10/DDP family zinc finger Length = 93 Score = 35.9 bits (79), Expect = 0.017 Identities = 17/72 (23%), Positives = 35/72 (48%), Gaps = 3/72 (4%) Frame = +3 Query: 132 MDALSTGTLSGAQKEEL--MDQVKQQIAIANAQELLTKMTEKCFKKCINK-PGTSLDSSE 302 MDA L G +E+ M + Q+ + ++ + + E+CF C++ SL E Sbjct: 1 MDASMMAGLDGLPEEDKAKMASMIDQLQLRDSLRMYNSLVERCFVDCVDSFTRKSLQKQE 60 Query: 303 QKCIAMCMDRYM 338 + C+ C ++++ Sbjct: 61 ETCVMRCAEKFL 72 >At5g15730.1 68418.m01840 serine/threonine protein kinase, putative similar to protein-serine/threonine kinase [Nicotiana tabacum] gi|505146|dbj|BAA06538 Length = 434 Score = 29.1 bits (62), Expect = 1.9 Identities = 15/58 (25%), Positives = 28/58 (48%) Frame = +3 Query: 102 IVAVNKNNNIMDALSTGTLSGAQKEELMDQVKQQIAIANAQELLTKMTEKCFKKCINK 275 I A++ N+M+ ++ ++S +E++DQ A LL K+ +C K K Sbjct: 305 ITAIHPQQNLMEYINLASMSPDGIDEILDQKLVGNASIEEVRLLAKIANRCVHKTPRK 362 >At2g35075.1 68415.m04303 hypothetical protein Length = 485 Score = 28.7 bits (61), Expect = 2.6 Identities = 16/59 (27%), Positives = 27/59 (45%) Frame = -3 Query: 419 VVFTALHVVSLALNSTAVCPRYEIP*IHVPIHTHSYALLFGAIQRSTWLIDALFETFFS 243 V A H +SL L + A+ ++ +P S ALL+ +++ S W + F S Sbjct: 102 VSLDAGHAISLDLETAALKMSADLNRTEIPSSVSSKALLYESLKPSIWWVSYAFANLMS 160 >At5g09420.1 68418.m01091 chloroplast outer membrane translocon subunit, putative similar to component of chloroplast outer membrane translocon Toc64 [Pisum sativum] GI:7453538; contains Pfam profiles PF01425: Amidase, PF00515: TPR Domain Length = 603 Score = 27.5 bits (58), Expect = 5.9 Identities = 10/35 (28%), Positives = 18/35 (51%) Frame = -2 Query: 432 FYSRSSVYSLTCCFSRVEFDCCMSSIRDSMNPCTY 328 + +R++ + CCF + E DC + + D N Y Sbjct: 525 YCNRAAAFLELCCFQQAEQDCTKAMLIDKKNVKAY 559 >At5g47990.1 68418.m05929 cytochrome P450 family protein similar to Cytochrome P450 93A3 (P450 CP5) (SP:O81973) [Glycine max]; Length = 511 Score = 27.1 bits (57), Expect = 7.9 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -2 Query: 414 VYSLTCCFSRVEFDCCMSSIRDSMNPCTYP 325 ++ L C FSR+ +D +DS C P Sbjct: 14 IFLLLCLFSRLSYDLFFRKTKDSRAGCALP 43 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,772,895 Number of Sequences: 28952 Number of extensions: 181170 Number of successful extensions: 494 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 482 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 492 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 984125600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -