BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10i11 (702 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylch... 26 1.00 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 25 3.0 EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 24 5.3 AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR prot... 23 9.3 >AY705403-1|AAU12512.1| 520|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 8 protein. Length = 520 Score = 26.2 bits (55), Expect = 1.00 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 603 MPDLDSSVPTTGYNNGVGM 547 +PD D S P+ GY N + M Sbjct: 367 LPDYDDSTPSNGYTNEIEM 385 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 24.6 bits (51), Expect = 3.0 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 61 FSKMSETLKLRGTLRGHNGWVTQ 129 F K+ E ++ LRG+ W+TQ Sbjct: 396 FQKLREKQQIEEDLRGYLDWITQ 418 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 23.8 bits (49), Expect = 5.3 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +1 Query: 286 SDGNYALSGSWDKTLRLWDLAAGKTTRRFEDHTKDVL 396 SDG + +KT RLW RR+ + D++ Sbjct: 404 SDGKKPPNNPLEKTNRLWGGVINDIKRRYPMYKSDIM 440 >AY391746-1|AAR28996.1| 502|Anopheles gambiae putative GPCR protein. Length = 502 Score = 23.0 bits (47), Expect = 9.3 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = +2 Query: 227 VYLKSVYTVIRTSFLMLCCLVTVITPFPVLGTRLCVCG 340 +YL++ +T + + CC + +T F + CV G Sbjct: 396 IYLETEHTNMNIYLVQNCCQLFFMTNFGINFILYCVSG 433 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 805,818 Number of Sequences: 2352 Number of extensions: 16498 Number of successful extensions: 33 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71504505 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -