BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10i08 (610 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17C9.03 |tif471||translation initiation factor eIF4G |Schizo... 28 1.2 SPAC1071.01c |pta1|SPAC4H3.15c|mRNA cleavage and polyadenylation... 26 3.7 >SPAC17C9.03 |tif471||translation initiation factor eIF4G |Schizosaccharomyces pombe|chr 1|||Manual Length = 1403 Score = 27.9 bits (59), Expect = 1.2 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Frame = -1 Query: 499 NTTPCPSQQTEVRASNSEALRGFYL--QRSYHTSRRELQNFIPARLHEPFKALH 344 NTT +Q T+V ASNS AL G S ++R+ NF R ++ + H Sbjct: 258 NTTDPATQTTQVSASNSPALSGSSTPSNTSSRSNRQNHGNFSEKRHYDRYGNSH 311 >SPAC1071.01c |pta1|SPAC4H3.15c|mRNA cleavage and polyadenylation specificity factor complex subunit Pta1|Schizosaccharomyces pombe|chr 1|||Manual Length = 670 Score = 26.2 bits (55), Expect = 3.7 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 499 STDNL*SEIKKKLNQSIFTANSVICIVCIKFNKCVIL 609 ST + +++K ++ N + I CIKF CVIL Sbjct: 116 STWDTLTKLKNEIINDFDKGNKPLLISCIKFISCVIL 152 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,166,129 Number of Sequences: 5004 Number of extensions: 38813 Number of successful extensions: 94 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 94 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 94 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 268287866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -