BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10i08 (610 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z80216-2|CAB02279.2| 239|Caenorhabditis elegans Hypothetical pr... 27 7.9 Z71179-1|CAA94888.1| 224|Caenorhabditis elegans Hypothetical pr... 27 7.9 >Z80216-2|CAB02279.2| 239|Caenorhabditis elegans Hypothetical protein F10G8.2 protein. Length = 239 Score = 27.5 bits (58), Expect = 7.9 Identities = 15/59 (25%), Positives = 30/59 (50%) Frame = -2 Query: 492 HLVHHSKLRSELRTQKL*GASTYREATIHLVVSFKTSFLLGCMNRSRLFIFRKRGQGQL 316 H+VH+ + + T K +ST +HL+ T++L + ++ F+ K G G++ Sbjct: 107 HVVHNFSSKLLVNTTKYSRSSTVMRFNLHLITRKSTNYLWR-LEKNANFVIVKTGIGKM 164 >Z71179-1|CAA94888.1| 224|Caenorhabditis elegans Hypothetical protein F07D3.3 protein. Length = 224 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = -1 Query: 520 HFTNCL*NTTPCPSQQTEVRASNSEALRGFYLQRSYHTSRRELQ 389 H N + NT P P Q + N ++ FY S+ +R L+ Sbjct: 27 HIDNLICNTYPTPIQLRKSPTRNETSINAFYQYSSFVDARNALR 70 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,261,236 Number of Sequences: 27780 Number of extensions: 229663 Number of successful extensions: 611 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 601 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 611 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1311096392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -