BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10i08 (610 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. 22 4.1 DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein ... 21 7.1 AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein ... 21 7.1 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 21 9.4 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 9.4 >L10710-1|AAA27730.1| 382|Apis mellifera hyaluronidase protein. Length = 382 Score = 22.2 bits (45), Expect = 4.1 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +2 Query: 278 SPCRRSVVRDYAVSWPCPRFLKMKSLERFMQPS 376 +P VR++ V W P F+ K RF + S Sbjct: 33 TPDNNKTVREFNVYWNVPTFMCHKYGLRFEEVS 65 >DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein 4 protein. Length = 128 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -1 Query: 517 FTNCL*NTTPCPSQQTEVRASNSEAL 440 + NCL + PC E++ + +AL Sbjct: 46 YVNCLLDQGPCTPDAAELKRNLPDAL 71 >AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein protein. Length = 128 Score = 21.4 bits (43), Expect = 7.1 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -1 Query: 517 FTNCL*NTTPCPSQQTEVRASNSEAL 440 + NCL + PC E++ + +AL Sbjct: 46 YVNCLLDQGPCTPDAAELKRNLPDAL 71 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.0 bits (42), Expect = 9.4 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 525 DFTSQIVCRTQHLVHHSK 472 DFTS + R HLV+ K Sbjct: 122 DFTSDVTERDNHLVNAFK 139 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.0 bits (42), Expect = 9.4 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = +2 Query: 161 EDRSFGAPPYLRWSKMKPKRSTRK 232 E S+G PY WS +S K Sbjct: 830 EVMSYGERPYWNWSNQDVIKSIEK 853 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,630 Number of Sequences: 438 Number of extensions: 2939 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17971191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -