BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10i07 (709 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 22 4.3 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 7.4 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 9.8 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 9.8 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 9.8 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 9.8 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 21 9.8 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 21 9.8 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 22.2 bits (45), Expect = 4.3 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = +3 Query: 138 DEDNKMSSENTKEEINEQVPINEKDNVNNKDEFENRS 248 DE+ + + E + E+ E D+ NN ++ E S Sbjct: 436 DEETSTTVFSNVEVVQEEAKKEESDSNNNNNKEEGNS 472 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 7.4 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = +3 Query: 519 LVIFMGAWSDRTGNR 563 ++I +G W+D GN+ Sbjct: 2394 VLIALGGWNDSAGNK 2408 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.8 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -2 Query: 684 GISLLGTLWFRLESHKRSKCSIHCSR 607 G+ GTL F K K ++ C+R Sbjct: 86 GVISKGTLLFMTSQLKPDKVTVFCNR 111 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.8 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -2 Query: 684 GISLLGTLWFRLESHKRSKCSIHCSR 607 G+ GTL F K K ++ C+R Sbjct: 86 GVISKGTLLFMTSQLKPDKVTVFCNR 111 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.8 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -2 Query: 684 GISLLGTLWFRLESHKRSKCSIHCSR 607 G+ GTL F K K ++ C+R Sbjct: 86 GVISKGTLLFMTSQLKPDKVTVFCNR 111 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.0 bits (42), Expect = 9.8 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -2 Query: 684 GISLLGTLWFRLESHKRSKCSIHCSR 607 G+ GTL F K K ++ C+R Sbjct: 86 GVISKGTLLFMTSQLKPDKVTVFCNR 111 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 21.0 bits (42), Expect = 9.8 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +2 Query: 455 PANNFTY*IMEDYYTDRHTHTSGYLHGS 538 P+N FT +++ RHT TS G+ Sbjct: 265 PSNRFTRHLIQRRTHTRHTTTSHNTRGT 292 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 21.0 bits (42), Expect = 9.8 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 572 HTPPNLR*IYGLREQCIE 625 +TPP L +YG EQ E Sbjct: 138 YTPPRLPTVYGKPEQNYE 155 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,538 Number of Sequences: 336 Number of extensions: 3823 Number of successful extensions: 9 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18738900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -