BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10i07 (709 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16975| Best HMM Match : MFS_1 (HMM E-Value=2.6e-24) 49 3e-06 SB_43212| Best HMM Match : MFS_1 (HMM E-Value=0.00051) 48 1e-05 SB_57014| Best HMM Match : PMP22_Claudin (HMM E-Value=4.6) 42 6e-04 SB_12219| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.69 SB_3878| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.69 SB_46756| Best HMM Match : zf-C2H2 (HMM E-Value=4.60046e-42) 31 0.69 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 31 0.92 SB_57480| Best HMM Match : MFS_1 (HMM E-Value=0.0025) 31 1.2 SB_15468| Best HMM Match : DNA_RNApol_7kD (HMM E-Value=7.4) 31 1.2 SB_49164| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_50520| Best HMM Match : zf-DNL (HMM E-Value=3.4) 29 4.9 SB_46673| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_36252| Best HMM Match : IQ (HMM E-Value=2.7e-35) 29 4.9 SB_22292| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_2974| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_34412| Best HMM Match : MARVEL (HMM E-Value=0.047) 28 6.5 SB_27864| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_27407| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_3318| Best HMM Match : Xan_ur_permease (HMM E-Value=7.20267e-43) 28 6.5 SB_50116| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_24592| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_24227| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_55829| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 SB_25135| Best HMM Match : VWA (HMM E-Value=2.2) 28 8.5 SB_3115| Best HMM Match : AAA (HMM E-Value=0) 28 8.5 >SB_16975| Best HMM Match : MFS_1 (HMM E-Value=2.6e-24) Length = 1193 Score = 49.2 bits (112), Expect = 3e-06 Identities = 45/178 (25%), Positives = 83/178 (46%), Gaps = 10/178 (5%) Frame = +3 Query: 177 EINEQVPINEKDNVNNKDEFENRSFFDKLCEIKSNITVEPIFA----GLIIPSTLARLAI 344 E N + ++ + ++D + S + + S ITVEP+ G+I+ + + I Sbjct: 4 EENNRSKDSKSPSPESEDSSSDTSLYRRFESCFSGITVEPVIFCYAFGIILHVPVIQQYI 63 Query: 345 -QNLNLDKACRVKSQFGD--VVCDALIERKGNYTTQEA--EIQQIISHIESWRTIIQTAI 509 Q L+ K + D C+ + + T E E+Q S+++ ++ + Sbjct: 64 HQRLSEGKGLTYEYNNTDSRTTCEPIQMANSSEETLELQKEVQAEASYMQMG-LVLSVST 122 Query: 510 PTLLV-IFMGAWSDRTGNRKICILLPIFGEFMVCVSNVLSTYFFYEIPVETTMFLEAI 680 P+LLV + +GAWSDR G R+ + +PIFG S ++ ++E+PV + E I Sbjct: 123 PSLLVALLLGAWSDRAGRRR-AMAMPIFGS--AVESAIILVIMYFELPVTFLLLAEFI 177 >SB_43212| Best HMM Match : MFS_1 (HMM E-Value=0.00051) Length = 446 Score = 47.6 bits (108), Expect = 1e-05 Identities = 32/121 (26%), Positives = 63/121 (52%), Gaps = 1/121 (0%) Frame = +3 Query: 279 NITVEPIFAGLIIPSTLARLAIQNLNLDKACRVKSQFGDVVCDALIERKGNYTTQEAEIQ 458 +ITVEP+ + + ++ +Q L K C K + C+ L +Y ++ +Q Sbjct: 9 SITVEPVLFLYMFCTFMSSPLLQQLAYRKIC--KEHYNTSACNNL----SDYQNEQNYVQ 62 Query: 459 QIISHIESWRTIIQTAIPTLLV-IFMGAWSDRTGNRKICILLPIFGEFMVCVSNVLSTYF 635 S+ ++ + A+P++ + +GAWSDR G + I IL P+ G ++ ++ +L+ +F Sbjct: 63 TSTSNWMRYQALA-LALPSIASSLVLGAWSDRVGRKAIMILPPV-GNILMNINYMLNVHF 120 Query: 636 F 638 F Sbjct: 121 F 121 >SB_57014| Best HMM Match : PMP22_Claudin (HMM E-Value=4.6) Length = 177 Score = 41.5 bits (93), Expect = 6e-04 Identities = 33/143 (23%), Positives = 63/143 (44%), Gaps = 4/143 (2%) Frame = +3 Query: 282 ITVEPIFAGLIIPSTLARLAIQNLNLDKACRVKSQFGDVVCDALIERKGNYTTQ----EA 449 +T+EP+ + + IQ K + K F D + Y + E Sbjct: 12 LTIEPVIFLYVYGILMHGPVIQQFVYSKIAKQKGFFYDPSSHTGCGNETRYNSTLHNLEQ 71 Query: 450 EIQQIISHIESWRTIIQTAIPTLLVIFMGAWSDRTGNRKICILLPIFGEFMVCVSNVLST 629 E+Q ++++ T+ ++ +L + +G+WSD G RK ILLP+ G + V ++ Sbjct: 72 EVQATAAYVQIGITMFESLPSIVLSLMVGSWSDCHG-RKPAILLPVIGSMLEAVCVLIVM 130 Query: 630 YFFYEIPVETTMFLEAIFPAITG 698 Y ++ V +F+ A+ +G Sbjct: 131 YCDLDVYV---LFIGALLNGCSG 150 >SB_12219| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 31.5 bits (68), Expect = 0.69 Identities = 16/56 (28%), Positives = 27/56 (48%) Frame = +3 Query: 126 KLSRDEDNKMSSENTKEEINEQVPINEKDNVNNKDEFENRSFFDKLCEIKSNITVE 293 K + +++ S EN E VP EKD+ D N + ++ E+K+ + VE Sbjct: 4 KSTNGDESVQSGENDLENNRALVPFKEKDSGTTADSSGNETDDSEVNELKAQVAVE 59 >SB_3878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 31.5 bits (68), Expect = 0.69 Identities = 12/47 (25%), Positives = 27/47 (57%) Frame = +3 Query: 105 VLVSVYFKLSRDEDNKMSSENTKEEINEQVPINEKDNVNNKDEFENR 245 ++V + D+++++ +E+ NE+ I E+++ N K+E E R Sbjct: 129 LMVKRKLREKEDDNDEVEEIEKREDANEKEEIEEREDANEKEEIEER 175 Score = 31.5 bits (68), Expect = 0.69 Identities = 12/37 (32%), Positives = 24/37 (64%) Frame = +3 Query: 135 RDEDNKMSSENTKEEINEQVPINEKDNVNNKDEFENR 245 R++DN+ +E+ NE+ I+E+++ N ++E E R Sbjct: 175 REDDNEKEEIEEREDDNEKEEIDEREDDNEEEEIEER 211 Score = 30.3 bits (65), Expect = 1.6 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +3 Query: 135 RDEDNKMSSENTKEEINEQVPINEKDNVNNKDEFENR 245 R++ N+ +E+ NE+ I E+++ N K+E E R Sbjct: 151 REDANEKEEIEEREDANEKEEIEEREDDNEKEEIEER 187 Score = 28.3 bits (60), Expect = 6.5 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +3 Query: 135 RDEDNKMSSENTKEEINEQVPINEKDNVNNKDEFENR 245 R++ N+ +E+ NE+ I E+++ N K+E + R Sbjct: 163 REDANEKEEIEEREDDNEKEEIEEREDDNEKEEIDER 199 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/33 (30%), Positives = 21/33 (63%) Frame = +3 Query: 135 RDEDNKMSSENTKEEINEQVPINEKDNVNNKDE 233 ++E + +N KEEI E+ NEK+ ++ +++ Sbjct: 169 KEEIEEREDDNEKEEIEEREDDNEKEEIDERED 201 Score = 28.3 bits (60), Expect = 6.5 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 4/40 (10%) Frame = +3 Query: 135 RDEDNKMSSENTKEEINEQVPINEK----DNVNNKDEFEN 242 R++DN+ + +E+ NE+ I E+ D V +DE EN Sbjct: 187 REDDNEKEEIDEREDDNEEEEIEEREDDDDEVEERDETEN 226 Score = 27.9 bits (59), Expect = 8.5 Identities = 11/42 (26%), Positives = 22/42 (52%) Frame = +3 Query: 135 RDEDNKMSSENTKEEINEQVPINEKDNVNNKDEFENRSFFDK 260 ++E + N KEEI E+ NEK+ + +++ + D+ Sbjct: 157 KEEIEEREDANEKEEIEEREDDNEKEEIEEREDDNEKEEIDE 198 >SB_46756| Best HMM Match : zf-C2H2 (HMM E-Value=4.60046e-42) Length = 1078 Score = 31.5 bits (68), Expect = 0.69 Identities = 19/67 (28%), Positives = 37/67 (55%) Frame = +3 Query: 93 TRDNVLVSVYFKLSRDEDNKMSSENTKEEINEQVPINEKDNVNNKDEFENRSFFDKLCEI 272 +R N V +S+D+D ++S+N++ I+ +VP K N K E + +++CE+ Sbjct: 161 SRQNSEECVNKSISKDKD--LNSDNSERSIDNRVPEERKSNSEQKSE---QLTNNRICEV 215 Query: 273 KSNITVE 293 S+ + E Sbjct: 216 NSSDSEE 222 >SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) Length = 1029 Score = 31.1 bits (67), Expect = 0.92 Identities = 18/72 (25%), Positives = 35/72 (48%) Frame = +3 Query: 108 LVSVYFKLSRDEDNKMSSENTKEEINEQVPINEKDNVNNKDEFENRSFFDKLCEIKSNIT 287 ++ + F+L+ D + ++S +NT E+I +P ++K + FEN IKS + Sbjct: 113 VIGLEFRLA-DSNKEISVQNTLEDIEVVIPADQKSARKFTNTFENNKNRTHFYRIKSEVA 171 Query: 288 VEPIFAGLIIPS 323 + + PS Sbjct: 172 LNSPLLIYVEPS 183 >SB_57480| Best HMM Match : MFS_1 (HMM E-Value=0.0025) Length = 930 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/70 (27%), Positives = 36/70 (51%) Frame = +3 Query: 444 EAEIQQIISHIESWRTIIQTAIPTLLVIFMGAWSDRTGNRKICILLPIFGEFMVCVSNVL 623 E E+Q S + + + + +V F G+++DR G RK ++ P+ G + + VL Sbjct: 69 EMEVQSASSELYMYYLGVWALSISFIVPFTGSYTDRRG-RKPGLIAPLVGAILETL--VL 125 Query: 624 STYFFYEIPV 653 ++E+PV Sbjct: 126 FLVLYFELPV 135 >SB_15468| Best HMM Match : DNA_RNApol_7kD (HMM E-Value=7.4) Length = 212 Score = 30.7 bits (66), Expect = 1.2 Identities = 14/53 (26%), Positives = 28/53 (52%) Frame = +3 Query: 102 NVLVSVYFKLSRDEDNKMSSENTKEEINEQVPINEKDNVNNKDEFENRSFFDK 260 N + V +L R +++ + + N +E+ E+ E+ NN DEF +S + + Sbjct: 58 NKIKVVEGELQRIDNDLIQNVNDSDELRERTEECERQQANNTDEFVRQSLYSR 110 >SB_49164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 457 Score = 29.1 bits (62), Expect = 3.7 Identities = 20/70 (28%), Positives = 35/70 (50%) Frame = +3 Query: 444 EAEIQQIISHIESWRTIIQTAIPTLLVIFMGAWSDRTGNRKICILLPIFGEFMVCVSNVL 623 E E+Q S + + + + +V F G+++DR G RK ++ P+ G + + VL Sbjct: 87 EIEVQSASSELYLYYLGVWALSISFIVPFTGSYTDRRG-RKPGLIAPLVGAILETLVLVL 145 Query: 624 STYFFYEIPV 653 Y E+PV Sbjct: 146 VLYL--ELPV 153 >SB_50520| Best HMM Match : zf-DNL (HMM E-Value=3.4) Length = 277 Score = 28.7 bits (61), Expect = 4.9 Identities = 10/37 (27%), Positives = 22/37 (59%) Frame = +3 Query: 135 RDEDNKMSSENTKEEINEQVPINEKDNVNNKDEFENR 245 R NK+ +E + I+ ++ +++ N NN+DE + + Sbjct: 93 RIASNKVDAEKVDKAIDRKISLHKHSNYNNEDELKEK 129 >SB_46673| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +3 Query: 132 SRDEDNKMSSENTKEEINEQVPINEKDNVNNKDEFENRS 248 + + DNK + N+ E + NE DN N+ +E +N + Sbjct: 31 NNNSDNKNDNNNSDNENDNNNSYNENDNSNSDNENDNNN 69 >SB_36252| Best HMM Match : IQ (HMM E-Value=2.7e-35) Length = 442 Score = 28.7 bits (61), Expect = 4.9 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +3 Query: 132 SRDEDNKMSSENTKEEINEQVPINEKDNVNNKDE 233 +R+E ++ ++E E+VP+NE++ N E Sbjct: 128 AREEVKELMKSKSRESTREEVPMNEQETANTNAE 161 >SB_22292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1047 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/41 (29%), Positives = 24/41 (58%) Frame = +3 Query: 126 KLSRDEDNKMSSENTKEEINEQVPINEKDNVNNKDEFENRS 248 K++ + + K +E++KEE+ E + +N+N K+E S Sbjct: 24 KMTENLNKKEEAESSKEEVKEVLKRKMTENLNKKEEMRKIS 64 >SB_2974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 325 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = +3 Query: 126 KLSRDEDNKMSSENTKEEINEQVPINEKDNVNNKDEFENRSFFDKLC 266 KL DED +E+ ++++ P N ++ ++DE E+ C Sbjct: 106 KLPSDEDTNGETEDDEDDVLPCTPENNNEDAPDRDELEHCEISPNRC 152 >SB_34412| Best HMM Match : MARVEL (HMM E-Value=0.047) Length = 441 Score = 28.3 bits (60), Expect = 6.5 Identities = 15/54 (27%), Positives = 31/54 (57%) Frame = +3 Query: 165 NTKEEINEQVPINEKDNVNNKDEFENRSFFDKLCEIKSNITVEPIFAGLIIPST 326 N++++ N ++ I +D+ D EN++ ++K C+ ++ I + P II ST Sbjct: 236 NSRKDSNRRLQIIPRDSY---DYMENQALYNKACKTRALIGLYPFSMYFIILST 286 >SB_27864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 153 MSSENTKEEINEQVPINEKDNVNNKDEFENRS 248 +S ENT +IN ++P EK + +K++ NRS Sbjct: 4 LSEENTLLDINIELP-QEKKTLKSKEDLRNRS 34 >SB_27407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 153 MSSENTKEEINEQVPINEKDNVNNKDEFENRS 248 +S ENT +IN ++P EK + +K++ NRS Sbjct: 4 LSEENTLLDINIELP-QEKKTLKSKEDLRNRS 34 >SB_3318| Best HMM Match : Xan_ur_permease (HMM E-Value=7.20267e-43) Length = 774 Score = 28.3 bits (60), Expect = 6.5 Identities = 17/62 (27%), Positives = 32/62 (51%), Gaps = 2/62 (3%) Frame = +3 Query: 54 YKLFYRHRVK*TLTRDNVLVSVYFKL--SRDEDNKMSSENTKEEINEQVPINEKDNVNNK 227 Y+L+ RH+ T T+ N+L+ + L + +++N ++ N N N +N NN Sbjct: 558 YRLYMRHQQ--TSTKLNLLLLLLLLLYNNNNDNNNNNNNNNNNNNNNNNNNNNNNNNNNA 615 Query: 228 DE 233 D+ Sbjct: 616 DD 617 >SB_50116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 27.9 bits (59), Expect = 8.5 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 138 DEDNKMSSENTKEEINEQVPINEKDNVNNKD 230 D DN ++N + N+ IN+ DN N+ D Sbjct: 48 DNDNDNDNDNDNDNDNDNDNINDNDNDNDND 78 Score = 27.9 bits (59), Expect = 8.5 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 138 DEDNKMSSENTKEEINEQVPINEKDNVNNKD 230 D DN ++N + IN+ N+ DN N+ D Sbjct: 54 DNDNDNDNDNDNDNINDNDNDNDNDNDNDND 84 >SB_24592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 335 Score = 27.9 bits (59), Expect = 8.5 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 2/45 (4%) Frame = +3 Query: 96 RDNVLVSVYFKLSRDEDNKMSSENTKE-EINEQVPI-NEKDNVNN 224 RD V V+F + + D + S+ T+E +I+ + I N +D NN Sbjct: 106 RDGVKWGVFFAMGKTGDTSLDSKTTREAQIHNDILIGNFRDTYNN 150 >SB_24227| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 27.9 bits (59), Expect = 8.5 Identities = 21/75 (28%), Positives = 37/75 (49%), Gaps = 2/75 (2%) Frame = +3 Query: 105 VLVSVYFKLSRDEDNKMSSENTKEEINEQVPINEKDNVNNKDEFENRSFFDKLCEIKSN- 281 VL S+ +KL +++S EN E+ +V +NE D + K + E K + SN Sbjct: 174 VLDSIAYKLDDCFTDRVS-ENIIEDTKNKVKLNEDDFITRKKQLERYLDVTKSQMLFSNG 232 Query: 282 -ITVEPIFAGLIIPS 323 + E + L++P+ Sbjct: 233 ILFAEGVSEELLVPA 247 >SB_55829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 27.9 bits (59), Expect = 8.5 Identities = 15/52 (28%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +3 Query: 93 TRDNVLVSVYFKLSRDEDNKMSSENTKEE-INEQVPINEKDNVNNKDEFENR 245 TRDN+L + +RD ++ E+T+E +N++ + +DN+++ +E R Sbjct: 455 TRDNMLNQEEKRDTRDNLSRGEEEHTRENMLNQEGKRDTRDNLSHGEEEHTR 506 >SB_25135| Best HMM Match : VWA (HMM E-Value=2.2) Length = 233 Score = 27.9 bits (59), Expect = 8.5 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +3 Query: 138 DEDNKMSSENTKEEINEQVPINEKDNVNNKDEFEN 242 D DN + +++N ++ D+VNN D+ +N Sbjct: 169 DVDNNDDDVDNADDVNNADDVDNNDDVNNADDADN 203 >SB_3115| Best HMM Match : AAA (HMM E-Value=0) Length = 913 Score = 27.9 bits (59), Expect = 8.5 Identities = 9/36 (25%), Positives = 25/36 (69%) Frame = +3 Query: 135 RDEDNKMSSENTKEEINEQVPINEKDNVNNKDEFEN 242 +D+D+ + +N K++ + V N+KD+ ++ D++++ Sbjct: 790 KDDDDSVVDDNDKDDDDSVVDDNDKDDDDSVDDYDD 825 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,515,201 Number of Sequences: 59808 Number of extensions: 450829 Number of successful extensions: 1516 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 1154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1468 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1865706635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -