BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10i05 (441 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1||... 29 0.24 SPCC622.15c |||sequence orphan|Schizosaccharomyces pombe|chr 3||... 28 0.55 SPBC21D10.06c |map4||cell agglutination protein Map4|Schizosacch... 28 0.73 SPCC1235.01 ||SPCC320.02c|sequence orphan|Schizosaccharomyces po... 27 1.7 SPBC1685.01 |pmp1||dual-specificity MAP kinase phosphatase Pmp1|... 27 1.7 SPAC9G1.02 |wis4|wak1, wik1|MAP kinase kinase kinase Wis4|Schizo... 27 1.7 SPAC1F7.01c |spt6|SPAC694.07c|transcription elongation factor Sp... 25 5.2 SPBC776.14 |plh1||phospholipid-diacylglycerol acyltransferase Pl... 25 5.2 SPAPB2B4.01c |gpi12||pig-L|Schizosaccharomyces pombe|chr 1|||Manual 25 6.8 SPCP1E11.02 |ppk38||Ark1/Prk1 family protein kinase Ppk38|Schizo... 24 9.0 SPBC19C2.05 |ran1|pat1|serine/threonine protein kinase Ran1|Schi... 24 9.0 SPBC27B12.11c |||transcription factor |Schizosaccharomyces pombe... 24 9.0 SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo... 24 9.0 SPBC1709.13c |||lysine methyltransferase |Schizosaccharomyces po... 24 9.0 >SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1367 Score = 29.5 bits (63), Expect = 0.24 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -3 Query: 295 NFLRYSLLPTASTRERGRLEVRSALGRVHVICTVVDRFV 179 NF ++P STR+R + +R G +H+IC D + Sbjct: 756 NFRVLDIIPFTSTRKRMSVIIRDEDGIIHLICKGADTVI 794 >SPCC622.15c |||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 557 Score = 28.3 bits (60), Expect = 0.55 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 4/39 (10%) Frame = +2 Query: 155 DYNPNG-NGYEPIDNGAYYVDPPQG---RPYFKPTPFPG 259 DYN N N Y PI N Y+++ G PYF PG Sbjct: 119 DYNNNRKNFYPPIQNSTYFINATGGIDSMPYFGLNNAPG 157 >SPBC21D10.06c |map4||cell agglutination protein Map4|Schizosaccharomyces pombe|chr 2|||Manual Length = 948 Score = 27.9 bits (59), Expect = 0.73 Identities = 16/50 (32%), Positives = 29/50 (58%) Frame = +3 Query: 108 ATNLLTTARTSLILPKITTLMETATNLSTTVHITWTLPKADLTSSLPLSL 257 A+ L +++ T+ + P +T ET ++ S+ T T+ + TSS P+SL Sbjct: 234 ASTLESSSLTNTVSPTESTFYETKSSTSSVP--TQTIDSSSFTSSTPVSL 281 >SPCC1235.01 ||SPCC320.02c|sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 658 Score = 26.6 bits (56), Expect = 1.7 Identities = 15/55 (27%), Positives = 28/55 (50%) Frame = +3 Query: 90 PTLKETATNLLTTARTSLILPKITTLMETATNLSTTVHITWTLPKADLTSSLPLS 254 PT++ T T ++ T T + + TT+ + T + T T P + T+ LP++ Sbjct: 102 PTVETTTTPMVETT-TITPMVETTTITPMVEAMITLMEETMTTPMEETTTILPMA 155 >SPBC1685.01 |pmp1||dual-specificity MAP kinase phosphatase Pmp1|Schizosaccharomyces pombe|chr 2|||Manual Length = 278 Score = 26.6 bits (56), Expect = 1.7 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +2 Query: 149 PKDYNPNGNGYEPIDNGAYYVDPPQGRPYFKPT 247 PK PN N +P NG + PP Y KPT Sbjct: 46 PKASKPNSN--QPYPNGPVCIYPPNIYLYAKPT 76 >SPAC9G1.02 |wis4|wak1, wik1|MAP kinase kinase kinase Wis4|Schizosaccharomyces pombe|chr 1|||Manual Length = 1401 Score = 26.6 bits (56), Expect = 1.7 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +1 Query: 181 RTYRQRCILRGPSPRPTLLQAYPFPWCSRWEVKNIL 288 R + ++C R P RP + PW + + K I+ Sbjct: 1280 RDFIEQCFERDPEQRPRAVDLLTHPWITDFRKKTII 1315 >SPAC1F7.01c |spt6|SPAC694.07c|transcription elongation factor Spt6|Schizosaccharomyces pombe|chr 1|||Manual Length = 1365 Score = 25.0 bits (52), Expect = 5.2 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -3 Query: 139 DVRAVVNRFVAVSLSVG-HSQQSEDENHEEF 50 +VR V NRFVAV L G DE ++F Sbjct: 1056 NVRRVTNRFVAVKLDCGIDGNIKADEVSDDF 1086 >SPBC776.14 |plh1||phospholipid-diacylglycerol acyltransferase Plh1|Schizosaccharomyces pombe|chr 2|||Manual Length = 623 Score = 25.0 bits (52), Expect = 5.2 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +2 Query: 152 KDYNPNGNGYEPIDNGAYYVDPPQGRP 232 K Y +G G +P + G YY + P+G+P Sbjct: 479 KIYCVHGVG-KPTERGYYYTNNPEGQP 504 >SPAPB2B4.01c |gpi12||pig-L|Schizosaccharomyces pombe|chr 1|||Manual Length = 248 Score = 24.6 bits (51), Expect = 6.8 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 75 LCWLWPTLKETATNLLTTARTS 140 + W W TL TA +L+TA S Sbjct: 1 MIWFWSTLLVTAIAVLSTANES 22 >SPCP1E11.02 |ppk38||Ark1/Prk1 family protein kinase Ppk38|Schizosaccharomyces pombe|chr 3|||Manual Length = 650 Score = 24.2 bits (50), Expect = 9.0 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +2 Query: 119 IDNRPYIVNPPKDYNPNGNGYEPIDNGAY 205 +++ PY+ N D+N NGN P+ +Y Sbjct: 370 VNSMPYLSNG--DHNNNGNTSSPVSRFSY 396 >SPBC19C2.05 |ran1|pat1|serine/threonine protein kinase Ran1|Schizosaccharomyces pombe|chr 2|||Manual Length = 470 Score = 24.2 bits (50), Expect = 9.0 Identities = 21/72 (29%), Positives = 27/72 (37%), Gaps = 1/72 (1%) Frame = +2 Query: 17 SPVITRDHIKMKFFMIFVLALLAMANAQGNGYEPIDNRPYIVNPPKDYNPNGNGYEPIDN 196 +P+ H F+ A A+ N N Y PI PY N PN PI Sbjct: 388 TPLTAPIHATESFWPSAAAAAAAVHN-NANSYMPITPTPYPNNAKIFGYPNQPPLTPIPF 446 Query: 197 GAYYVDP-PQGR 229 + + P P GR Sbjct: 447 TGFVLHPAPVGR 458 >SPBC27B12.11c |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 738 Score = 24.2 bits (50), Expect = 9.0 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +2 Query: 98 QGNGYEPIDNRPYIVNPPKDYNPNGNGY 181 QG G + D PY ++P Y P G Y Sbjct: 186 QGAGVKA-DINPYNLSPYSQYGPEGTAY 212 >SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1224 Score = 24.2 bits (50), Expect = 9.0 Identities = 17/51 (33%), Positives = 22/51 (43%) Frame = +2 Query: 104 NGYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDPPQGRPYFKPTPFP 256 N Y PI VNP Y P+G G+ V PP+ +P + P P Sbjct: 982 NPYTPIAVASSTVNPAHTYKPHG--------GSQIVPPPK-QPANRVVPLP 1023 >SPBC1709.13c |||lysine methyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 547 Score = 24.2 bits (50), Expect = 9.0 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = +2 Query: 71 LALLAMANAQGNGYEPIDNRPYIVNPPKDYNPNGNGYEPIDNGAY 205 LAL ++ Q Y I+ P N P +N N N + I AY Sbjct: 86 LALESLKGIQSKWYGYIEYLPKTFNTPLYFNENDNAF-LISTNAY 129 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,625,607 Number of Sequences: 5004 Number of extensions: 35034 Number of successful extensions: 118 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 118 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 160149590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -