BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10i04 (692 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0087 + 14476539-14476675,14478876-14479635,14479720-144798... 29 3.5 06_03_1283 - 28957729-28959258,28959354-28959550,28959824-289600... 29 4.6 01_06_1092 + 34469732-34470118 28 6.1 >09_04_0087 + 14476539-14476675,14478876-14479635,14479720-14479871, 14479958-14480024,14480632-14480831,14480915-14481068, 14481585-14481669,14481766-14481857,14482575-14482766, 14482867-14482992,14483072-14483125,14483494-14483550, 14484509-14484606,14484703-14485038,14485116-14485203, 14486891-14487016,14487082-14487138,14488054-14488133, 14488228-14488270,14488948-14489034,14489331-14489420, 14489996-14490054,14490141-14490231,14490330-14490495, 14490662-14490755,14491787-14492909 Length = 1537 Score = 29.1 bits (62), Expect = 3.5 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 218 CATRDDPGLRVRYQGPCSEGNVGFP 292 C T+ DPG +R G EG+ G+P Sbjct: 745 CTTKVDPGPDIRTNGDSREGDTGWP 769 >06_03_1283 - 28957729-28959258,28959354-28959550,28959824-28960026, 28960097-28960424,28960524-28960661,28960765-28961020, 28961529-28961626,28963104-28963367,28964395-28964584 Length = 1067 Score = 28.7 bits (61), Expect = 4.6 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -1 Query: 545 HSLRGSRCCT*YRHCRRPASSRACTCTKGI 456 H+ + SRCC Y C RP SR+C C+ I Sbjct: 1032 HTSQASRCCRSYVKCSRP--SRSC-CSHSI 1058 >01_06_1092 + 34469732-34470118 Length = 128 Score = 28.3 bits (60), Expect = 6.1 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = +2 Query: 437 IVDGPSKYPSCT--CTREMKPVCGSDGITYNNDC 532 + DG S+ C C R PVCG+DG+TY C Sbjct: 46 VSDGGSEAQLCPVRCFRP-DPVCGADGVTYWCGC 78 Score = 27.9 bits (59), Expect = 8.1 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +2 Query: 149 CYRNQRPVCGTDGKTYNNECLLDCATRDDPGLRVRYQGPCSEG 277 C+R PVCG DG TY C G RV +G C G Sbjct: 60 CFRPD-PVCGADGVTY----WCGCPEAACAGARVARRGYCEVG 97 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,844,896 Number of Sequences: 37544 Number of extensions: 409027 Number of successful extensions: 998 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 957 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 998 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -