BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10i03 (668 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g26790.1 68416.m03351 transcriptional regulator (FUSCA3) iden... 28 4.9 At1g67220.1 68414.m07651 zinc finger protein-related similar to ... 28 6.5 >At3g26790.1 68416.m03351 transcriptional regulator (FUSCA3) identical to FUSCA3 GB:AAC35247 [Arabidopsis thaliana] (Plant J. 6, 379-387 (1994)) Length = 313 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = +2 Query: 566 GNFFGGYGDGYSDNFRVVARSTNEKKKVETV 658 G+F Y D YS+N+ + AR +E+++V+ + Sbjct: 172 GDFIMVYQDLYSNNYVIQARKASEEEEVDVI 202 >At1g67220.1 68414.m07651 zinc finger protein-related similar to SP|Q09472 E1A-associated protein p300 {Homo sapiens}, SP|Q92793 CREB-binding protein {Homo sapiens}; contains Pfam profiles PF00569: Zinc finger ZZ type, PF00628: PHD-finger, PF02135: TAZ zinc finger Length = 1357 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -1 Query: 515 QICSPGNRHCRSDIPVCTLHSPGTLKVRRSLPDN 414 QICSP + C++ P+C + ++RS DN Sbjct: 689 QICSPCHSRCKTKFPLCGVFIDKHKMLKRSNFDN 722 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,909,903 Number of Sequences: 28952 Number of extensions: 146707 Number of successful extensions: 477 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 477 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1412971776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -