Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmmt10h15
         (363 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q3LVX6 Cluster: Putative uncharacterized protein; n=1; ...    31   8.3  

>UniRef50_Q3LVX6 Cluster: Putative uncharacterized protein; n=1;
           Bigelowiella natans|Rep: Putative uncharacterized
           protein - Bigelowiella natans (Pedinomonas minutissima)
           (Chlorarachnion sp.(strain CCMP 621))
          Length = 867

 Score = 30.7 bits (66), Expect = 8.3
 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
 Frame = +1

Query: 187 IDS-NLMAAIRKISIIRNLFIINLQSAKL*SLRMFKTYFNYLMCIGLFVV 333
           +DS ++ + I +  I+ +LF+ N  S K+  L +F +YF+YL C  +  V
Sbjct: 414 VDSFSIQSCINQFLIMVHLFLTNDNSRKI--LIIFPSYFDYLFCFNVLGV 461


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 269,781,415
Number of Sequences: 1657284
Number of extensions: 4157803
Number of successful extensions: 5808
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 5696
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5806
length of database: 575,637,011
effective HSP length: 90
effective length of database: 426,481,451
effective search space used: 12794443530
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)