BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10h15 (363 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33874| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.1 SB_38076| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-05) 28 2.6 >SB_33874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 29.1 bits (62), Expect = 1.1 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = +3 Query: 210 HKKNQYYKKPFYH*PTKCQIVIFKNV*NIF*LPNVYRFVCCINIIFIYXKK 362 +KK YY P + T V +N+ I L + RF IN++F + KK Sbjct: 250 YKKGAYYSDPIFFLSTALHKVFPENLTKIIMLDSDLRFRNDINLLFQHFKK 300 >SB_38076| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-05) Length = 577 Score = 27.9 bits (59), Expect = 2.6 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +2 Query: 56 INTFNIFIPYLVSCVI 103 +N FNIF+ YL++C + Sbjct: 152 VNVFNIFVKYLIACTL 167 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,299,760 Number of Sequences: 59808 Number of extensions: 126272 Number of successful extensions: 161 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 155 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 161 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 570200590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -