BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10h12 (639 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 29 0.16 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 25 1.5 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 25 2.0 AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transpor... 23 8.2 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 28.7 bits (61), Expect = 0.16 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +2 Query: 317 TTTLQPAQQSSESPLLSGVGFVLLMTIVINAAWLLV 424 T T PA S+ P L + VLL++++ AW L+ Sbjct: 5 TETEVPAGSVSDEPFLGPLDIVLLVSLLAGTAWYLL 40 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 25.4 bits (53), Expect = 1.5 Identities = 14/28 (50%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = +2 Query: 302 ELSEPTTTLQPAQQSS--ESPLLSGVGF 379 E S TTTL P S E+PLLSG + Sbjct: 728 ETSSTTTTLTPPPSESGRETPLLSGPSY 755 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 25.0 bits (52), Expect = 2.0 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = -3 Query: 289 AIEASGAIEAMGTSSNVIGQSNQQPGIVDIGEHGQVTKDEATNPQ 155 +I G G S +IG + GIVD + + D +PQ Sbjct: 2058 SISGGGGTPGGGKSKGIIGSTQANIGIVDSNISPKESPDSIGDPQ 2102 >AF533893-1|AAM97678.1| 570|Anopheles gambiae ascorbate transporter protein. Length = 570 Score = 23.0 bits (47), Expect = 8.2 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +2 Query: 491 AACRLVLVFAGLVYLTMTITTPALMLHGLDIAVXSYFITVYNTYARQ 631 A +LVL F+GLV + I TP ++ + + + F T ++Q Sbjct: 157 AVTQLVLGFSGLVGKLLRIITPLTIVPTVALVGITLFQHASETASKQ 203 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 668,723 Number of Sequences: 2352 Number of extensions: 13460 Number of successful extensions: 45 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -