BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10h06 (554 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_02_0011 - 8513471-8513673,8513815-8513869 29 3.3 08_02_0337 - 15903990-15904249,15904318-15904441 28 4.4 12_01_1024 - 10467644-10469274,10469424-10469482,10469820-104703... 28 5.8 09_04_0350 + 16899076-16900164 28 5.8 11_01_0346 - 2589111-2589220,2589613-2589852,2589956-2590028,259... 27 7.6 05_04_0354 - 20545574-20545627,20546430-20546754,20547219-20547802 27 7.6 >04_02_0011 - 8513471-8513673,8513815-8513869 Length = 85 Score = 28.7 bits (61), Expect = 3.3 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +3 Query: 213 APCTTIGSTCLDCTTKQVCTKVGGIQRACLDPT-LPYCNLGECSATP 350 AP T + C+D T K +C+ + C L YCN C+ +P Sbjct: 33 APITEVPKPCVDATCKAICSDKYQSKGECFSTDGLYYCNF--CANSP 77 >08_02_0337 - 15903990-15904249,15904318-15904441 Length = 127 Score = 28.3 bits (60), Expect = 4.4 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -3 Query: 330 RGCSKEESGPNTPSVYLL 277 RGC +EE G N+PS+ LL Sbjct: 108 RGCMREEPGGNSPSLVLL 125 >12_01_1024 - 10467644-10469274,10469424-10469482,10469820-10470357, 10470975-10471666,10471912-10472062,10473797-10473864, 10473964-10474042,10474763-10474765,10476427-10477255 Length = 1349 Score = 27.9 bits (59), Expect = 5.8 Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -3 Query: 366 VHILQRG*RSILRGCSKEESGPNTPSVYLLLLYK-LAW 256 + + R S+LR +++ +G TP +Y+ +LY AW Sbjct: 191 MRVAPRARGSLLRAMARDVAGVTTPMLYVAMLYSWFAW 228 >09_04_0350 + 16899076-16900164 Length = 362 Score = 27.9 bits (59), Expect = 5.8 Identities = 21/41 (51%), Positives = 22/41 (53%) Frame = -1 Query: 221 ARSPLRVPGSGCDPWRYPRVDCAIVPASPTAGTTGGRLRDS 99 AR P V SG + WR R D A AS TAG GGR R S Sbjct: 71 ARRPWLV-SSGAEAWRR-RGDAASA-ASATAGGAGGRSRRS 108 >11_01_0346 - 2589111-2589220,2589613-2589852,2589956-2590028, 2590301-2590606,2590698-2590912,2591461-2591755, 2591901-2592065,2592142-2592738,2593029-2593115, 2593203-2593523,2594047-2596071 Length = 1477 Score = 27.5 bits (58), Expect = 7.6 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -2 Query: 259 LVVQSRQVLPMVVQGAHCGYQGADAIHGGIQGLT 158 L ++ RQ P+V+ G C ++G D I GI G T Sbjct: 1234 LKIKYRQDAPLVLHGITCTFEGGDKI--GIVGRT 1265 >05_04_0354 - 20545574-20545627,20546430-20546754,20547219-20547802 Length = 320 Score = 27.5 bits (58), Expect = 7.6 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 218 RSPLRVPGSGCDPWRYPRVDCAIVPASPTAG 126 R P ++P P+ +PR D A+ P+SP G Sbjct: 40 RQPAKIPA----PFVWPRADVALPPSSPPTG 66 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,822,030 Number of Sequences: 37544 Number of extensions: 297444 Number of successful extensions: 953 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 926 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 952 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1257681096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -