BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10h04 (607 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC365.11 |||GRIP domain protein|Schizosaccharomyces pombe|chr ... 26 4.9 SPBC211.02c |cwf3|syf1|complexed with Cdc5 protein Cwf3 |Schizos... 25 8.6 >SPBC365.11 |||GRIP domain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 266 Score = 25.8 bits (54), Expect = 4.9 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 350 QILIKTNSINLFSIRPQTISNNKSLTVNKEY 258 +IL K +S + S P ISN +NKEY Sbjct: 195 EILPKASSDSAGSFEPPVISNISKELINKEY 225 >SPBC211.02c |cwf3|syf1|complexed with Cdc5 protein Cwf3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 790 Score = 25.0 bits (52), Expect = 8.6 Identities = 11/58 (18%), Positives = 27/58 (46%) Frame = +3 Query: 135 ESKEGVQNPIIFLKLCINNTLINNKSITHTTTYLRHTFK*FILFVYRQTFVIAYSLWS 308 E+ + + + LK+ ++N ++ Y +FK + V ++ +A+ LW+ Sbjct: 497 ETTRKLYDRVFELKIATPQVVVNYANLLEENAYFEDSFKIYERGVALFSYPVAFELWN 554 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,163,711 Number of Sequences: 5004 Number of extensions: 39187 Number of successful extensions: 80 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 266270664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -