BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10g23 (735 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 41 5e-05 AY330183-1|AAQ16289.1| 190|Anopheles gambiae odorant-binding pr... 27 0.45 AJ618925-1|CAF02004.1| 204|Anopheles gambiae odorant-binding pr... 27 0.45 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 24 5.6 AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprol... 23 7.4 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 23 7.4 L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase pro... 23 9.8 AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase p... 23 9.8 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 40.7 bits (91), Expect = 5e-05 Identities = 27/93 (29%), Positives = 53/93 (56%) Frame = +2 Query: 356 DILLQESEQNEEEMLSVISKNTDLKKQLSQLFIEHSEALEINQKLQDTINTFSQCSDEFC 535 D + +E + +++ + S I+K +++ ++ E +EAL+ +KL D I T S+ E Sbjct: 404 DSVNREQKSDQDRLDSEINKKAQIEENYKKIESEKNEALKRQEKLIDHIKT-SRLGLE-- 460 Query: 536 DSLKITAELRHKLAEADDCISDLRSELCKLKEQ 634 + +I AEL + + + I +L+SEL ++EQ Sbjct: 461 EQKRIKAELSQDVGTSKERIHELQSELDNVREQ 493 >AY330183-1|AAQ16289.1| 190|Anopheles gambiae odorant-binding protein AgamOBP57 protein. Length = 190 Score = 27.5 bits (58), Expect = 0.45 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 518 CSDEFCDSLKITAELRHKLAEADDCISDLRSEL 616 C +EF D + ELR KL +D +SDL ++ Sbjct: 155 CPEEFRDDSEKCVELRDKLTNKED-VSDLHDDI 186 >AJ618925-1|CAF02004.1| 204|Anopheles gambiae odorant-binding protein OBP14426 protein. Length = 204 Score = 27.5 bits (58), Expect = 0.45 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 518 CSDEFCDSLKITAELRHKLAEADDCISDLRSEL 616 C +EF D + ELR KL +D +SDL ++ Sbjct: 169 CPEEFRDDSEKCVELRDKLTNKED-VSDLHDDI 200 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 23.8 bits (49), Expect = 5.6 Identities = 13/50 (26%), Positives = 26/50 (52%) Frame = +2 Query: 287 KSRQVDEQLRIALEQLKNTREKYDILLQESEQNEEEMLSVISKNTDLKKQ 436 ++R++DE+ R ++ + RE++ E + EEM + LK+Q Sbjct: 829 RARKIDEEERSLRQKQELEREEFKRRQAEDRRRMEEMRRKAHEEMLLKRQ 878 >AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprolinase protein. Length = 756 Score = 23.4 bits (48), Expect = 7.4 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +2 Query: 605 RSELCKLKEQQPQSLYSELVQSEPSLVAVDTA 700 R + +L Q+P +LY E+++ + LV A Sbjct: 113 RPNIFQLNIQKPANLYREVIEIDARLVPAQEA 144 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.4 bits (48), Expect = 7.4 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +2 Query: 605 RSELCKLKEQQPQSLYSELVQSEPSLVAVDTA 700 R + +L Q+P +LY E+++ + LV A Sbjct: 113 RPNIFQLNIQKPANLYREVIEIDARLVPAQEA 144 >L76038-1|AAC27383.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 23.0 bits (47), Expect = 9.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 538 ITKFITALRKGVNRI 494 + KF+ ALR G NRI Sbjct: 528 LDKFLVALRPGANRI 542 >AF031626-1|AAD01936.1| 683|Anopheles gambiae prophenoloxidase protein. Length = 683 Score = 23.0 bits (47), Expect = 9.8 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 538 ITKFITALRKGVNRI 494 + KF+ ALR G NRI Sbjct: 528 LDKFLVALRPGANRI 542 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 594,855 Number of Sequences: 2352 Number of extensions: 10700 Number of successful extensions: 29 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75260343 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -