BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10g17 (453 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC006417-1|AAH06417.2| 580|Homo sapiens XRN2 protein protein. 29 9.8 AY382900-1|AAR24369.1| 907|Homo sapiens 5'-3' exoribonuclease 2... 29 9.8 AL158013-2|CAH71495.1| 950|Homo sapiens 5'-3' exoribonuclease 2... 29 9.8 AL117332-2|CAI19756.1| 950|Homo sapiens 5'-3' exoribonuclease 2... 29 9.8 AK000084-1|BAA90934.1| 560|Homo sapiens protein ( Homo sapiens ... 29 9.8 AF152169-1|AAQ13577.1| 950|Homo sapiens DHP protein protein. 29 9.8 >BC006417-1|AAH06417.2| 580|Homo sapiens XRN2 protein protein. Length = 580 Score = 28.7 bits (61), Expect = 9.8 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -1 Query: 129 KIYWDRHELLPMLIYCKCLPMLFEIMSNLFFNINYNVP 16 K D +LP I C +PML ++ N +IN+ P Sbjct: 351 KFSLDEEAILPDQIVCSPVPMLRDLTQNTVVSINFKDP 388 >AY382900-1|AAR24369.1| 907|Homo sapiens 5'-3' exoribonuclease 2 isoform 3 protein. Length = 907 Score = 28.7 bits (61), Expect = 9.8 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -1 Query: 129 KIYWDRHELLPMLIYCKCLPMLFEIMSNLFFNINYNVP 16 K D +LP I C +PML ++ N +IN+ P Sbjct: 678 KFSLDEEAILPDQIVCSPVPMLRDLTQNTVVSINFKDP 715 >AL158013-2|CAH71495.1| 950|Homo sapiens 5'-3' exoribonuclease 2 protein. Length = 950 Score = 28.7 bits (61), Expect = 9.8 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -1 Query: 129 KIYWDRHELLPMLIYCKCLPMLFEIMSNLFFNINYNVP 16 K D +LP I C +PML ++ N +IN+ P Sbjct: 721 KFSLDEEAILPDQIVCSPVPMLRDLTQNTVVSINFKDP 758 >AL117332-2|CAI19756.1| 950|Homo sapiens 5'-3' exoribonuclease 2 protein. Length = 950 Score = 28.7 bits (61), Expect = 9.8 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -1 Query: 129 KIYWDRHELLPMLIYCKCLPMLFEIMSNLFFNINYNVP 16 K D +LP I C +PML ++ N +IN+ P Sbjct: 721 KFSLDEEAILPDQIVCSPVPMLRDLTQNTVVSINFKDP 758 >AK000084-1|BAA90934.1| 560|Homo sapiens protein ( Homo sapiens cDNA FLJ20077 fis, clone COL02904. ). Length = 560 Score = 28.7 bits (61), Expect = 9.8 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -1 Query: 129 KIYWDRHELLPMLIYCKCLPMLFEIMSNLFFNINYNVP 16 K D +LP I C +PML ++ N +IN+ P Sbjct: 331 KFSLDEEAILPDQIVCSPVPMLRDLTQNTVVSINFKDP 368 >AF152169-1|AAQ13577.1| 950|Homo sapiens DHP protein protein. Length = 950 Score = 28.7 bits (61), Expect = 9.8 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -1 Query: 129 KIYWDRHELLPMLIYCKCLPMLFEIMSNLFFNINYNVP 16 K D +LP I C +PML ++ N +IN+ P Sbjct: 721 KFSLDEEAILPDQIVCSPVPMLRDLTQNTVVSINFKDP 758 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 46,151,034 Number of Sequences: 237096 Number of extensions: 703711 Number of successful extensions: 1084 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1062 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1084 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 3758237868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -