BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10g08 (706 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50939| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_54060| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 >SB_50939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2337 Score = 28.7 bits (61), Expect = 4.9 Identities = 10/21 (47%), Positives = 14/21 (66%), Gaps = 2/21 (9%) Frame = +1 Query: 412 WCIFYCWYG--NVLWNLLLPC 468 +C+F+ W+ N LW LLPC Sbjct: 2296 YCLFFLWHRTRNKLWKTLLPC 2316 >SB_54060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 289 Score = 27.9 bits (59), Expect = 8.5 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = +2 Query: 311 KDDLKKIFETANRFHFLHTLALVTVPLCRRPY 406 + + KK+ ++ FHF + LA+ +P+C Y Sbjct: 75 ESEYKKVHNYSSMFHFSYFLAVFRLPVCTPAY 106 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,680,213 Number of Sequences: 59808 Number of extensions: 329306 Number of successful extensions: 550 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 530 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 550 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -