BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10g08 (706 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC030270-1|AAH30270.1| 113|Homo sapiens chromosome 17 open read... 104 4e-22 AY462870-1|AAS58864.1| 452|Homo sapiens POTE8B protein. 34 0.43 AY462869-1|AAS58863.1| 498|Homo sapiens POTE8A protein. 34 0.43 CR545463-1|CAM28350.1| 545|Homo sapiens protein expressed in pr... 33 0.99 AY466021-1|AAS58873.1| 288|Homo sapiens POTE22 protein. 33 0.99 AY465171-1|AAS58870.1| 594|Homo sapiens POTE14B protein. 33 0.99 >BC030270-1|AAH30270.1| 113|Homo sapiens chromosome 17 open reading frame 61 protein. Length = 113 Score = 104 bits (249), Expect = 4e-22 Identities = 51/115 (44%), Positives = 72/115 (62%), Gaps = 1/115 (0%) Frame = +2 Query: 203 LAQEAGPFVRLAGLSGAAAVILGAMGAHRT-FPETEAKDDLKKIFETANRFHFLHTLALV 379 +A A F RL LSGAAA+ + GAH FP+ K+ +F+ AN+ HFLH+LAL+ Sbjct: 1 MAGPAAAFRRLGALSGAAALGFASYGAHGAQFPDAYGKE----LFDKANKHHFLHSLALL 56 Query: 380 TVPLCRRPYIAGAFFIAGMGMFCGTCYYHAFTGDRKLRQVTPLGGTCLILGWIAM 544 VP CR+P AG +G +FC + YY A +GD ++ + P GGT L+LGW+A+ Sbjct: 57 GVPHCRKPLWAGLLLASGTTLFCTSFYYQALSGDPSIQTLAPAGGTLLLLGWLAL 111 >AY462870-1|AAS58864.1| 452|Homo sapiens POTE8B protein. Length = 452 Score = 34.3 bits (75), Expect = 0.43 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 244 KWCCCCNPWCYGSTSN 291 KWCCCC P C GS N Sbjct: 26 KWCCCCFPCCRGSGKN 41 >AY462869-1|AAS58863.1| 498|Homo sapiens POTE8A protein. Length = 498 Score = 34.3 bits (75), Expect = 0.43 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 244 KWCCCCNPWCYGSTSN 291 KWCCCC P C GS N Sbjct: 26 KWCCCCFPCCRGSGKN 41 >CR545463-1|CAM28350.1| 545|Homo sapiens protein expressed in prostate, ovary, testis, and8) pseudogene protein. Length = 545 Score = 33.1 bits (72), Expect = 0.99 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 244 KWCCCCNPWCYGS 282 KWCC C PWC GS Sbjct: 63 KWCCHCFPWCRGS 75 >AY466021-1|AAS58873.1| 288|Homo sapiens POTE22 protein. Length = 288 Score = 33.1 bits (72), Expect = 0.99 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 244 KWCCCCNPWCYGS 282 KWCC C PWC GS Sbjct: 63 KWCCHCFPWCRGS 75 >AY465171-1|AAS58870.1| 594|Homo sapiens POTE14B protein. Length = 594 Score = 33.1 bits (72), Expect = 0.99 Identities = 10/13 (76%), Positives = 10/13 (76%) Frame = +1 Query: 244 KWCCCCNPWCYGS 282 KWCC C PWC GS Sbjct: 63 KWCCHCFPWCRGS 75 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,999,185 Number of Sequences: 237096 Number of extensions: 1720520 Number of successful extensions: 2726 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2599 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2723 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8175213644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -