BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10g07 (680 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0421 - 3000486-3000595,3000909-3001148,3001659-3001722,300... 28 7.9 >06_01_0421 - 3000486-3000595,3000909-3001148,3001659-3001722, 3001969-3002274,3002365-3002579,3003047-3003341, 3003487-3003651,3003745-3004341,3004855-3004941, 3005022-3005342,3006218-3008242 Length = 1474 Score = 27.9 bits (59), Expect = 7.9 Identities = 21/100 (21%), Positives = 40/100 (40%), Gaps = 5/100 (5%) Frame = +2 Query: 215 TSDGHRAGQMKLWIHVLW-PAVAIVLKTTVLRRPI*IDLRITLRTY*IITMADSALGIL- 388 T D +R G+ W H +W +V + + +L + + +L I + ++ L L Sbjct: 406 TVDAYRIGEFPYWFHQIWTTSVQLCIALAILYNAVGLATVSSLVVIIITVLCNAPLAKLQ 465 Query: 389 ---WKKLK*GMDLELYTFGSVSTNISLLKIQCTVRHTRDV 499 KL D+ L ++ +LK+ H + V Sbjct: 466 HKYQSKLMEAQDVRLKAMSESLVHMKVLKLYAWENHFKKV 505 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,581,881 Number of Sequences: 37544 Number of extensions: 282931 Number of successful extensions: 555 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 541 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 555 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1721314888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -