BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10g05 (399 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC073275-1|AAQ93366.1| 111|Homo sapiens unknown protein. 29 4.3 BC121046-1|AAI21047.1| 153|Homo sapiens ADAM18 protein protein. 28 9.9 BC121045-1|AAI21046.1| 739|Homo sapiens ADAM metallopeptidase d... 28 9.9 AY358321-1|AAQ88687.1| 715|Homo sapiens ADAM18 protein. 28 9.9 AJ133004-1|CAB40812.1| 739|Homo sapiens tMDC III protein protein. 28 9.9 >AC073275-1|AAQ93366.1| 111|Homo sapiens unknown protein. Length = 111 Score = 29.5 bits (63), Expect = 4.3 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = -3 Query: 229 ICLFVFVTHSSKYFGWLKKKNNPTGN---DVYIAIL 131 +C++++ + YF +LK KN P N DVY IL Sbjct: 40 VCIYIYKRKTYIYFNYLKCKNLPNTNGKSDVYYIIL 75 >BC121046-1|AAI21047.1| 153|Homo sapiens ADAM18 protein protein. Length = 153 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 Query: 236 WEDLSFCICYPFFKIFWLVEKKEQSNRK*C 147 W LSFCI PFF +F V K K C Sbjct: 102 WFILSFCIFLPFFIVFTTVIFKRNEISKSC 131 >BC121045-1|AAI21046.1| 739|Homo sapiens ADAM metallopeptidase domain 18 protein. Length = 739 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 Query: 236 WEDLSFCICYPFFKIFWLVEKKEQSNRK*C 147 W LSFCI PFF +F V K K C Sbjct: 688 WFILSFCIFLPFFIVFTTVIFKRNEISKSC 717 >AY358321-1|AAQ88687.1| 715|Homo sapiens ADAM18 protein. Length = 715 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 Query: 236 WEDLSFCICYPFFKIFWLVEKKEQSNRK*C 147 W LSFCI PFF +F V K K C Sbjct: 664 WFILSFCIFLPFFIVFTTVIFKRNEISKSC 693 >AJ133004-1|CAB40812.1| 739|Homo sapiens tMDC III protein protein. Length = 739 Score = 28.3 bits (60), Expect = 9.9 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = -2 Query: 236 WEDLSFCICYPFFKIFWLVEKKEQSNRK*C 147 W LSFCI PFF +F V K K C Sbjct: 688 WFILSFCIFLPFFIVFTTVIFKRNEISKSC 717 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 57,167,946 Number of Sequences: 237096 Number of extensions: 1207444 Number of successful extensions: 2069 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2035 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2069 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2870859500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -