SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmmt10g02
         (684 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain tran...    23   2.3  
AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia or...    23   2.3  
AY618898-1|AAU87291.1|  803|Tribolium castaneum receptor tyrosin...    22   4.1  
AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory recept...    21   7.1  

>AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain
           transcription factor Maxillopediaprotein.
          Length = 523

 Score = 23.0 bits (47), Expect = 2.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = -1

Query: 108 ENMTNYNSFHSF 73
           E+  NYNSFH F
Sbjct: 472 ESSDNYNSFHQF 483


>AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia
           ortholog protein.
          Length = 471

 Score = 23.0 bits (47), Expect = 2.3
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = -1

Query: 108 ENMTNYNSFHSF 73
           E+  NYNSFH F
Sbjct: 420 ESSDNYNSFHQF 431


>AY618898-1|AAU87291.1|  803|Tribolium castaneum receptor tyrosine
           kinase Torso-likeprotein protein.
          Length = 803

 Score = 22.2 bits (45), Expect = 4.1
 Identities = 14/55 (25%), Positives = 22/55 (40%)
 Frame = -1

Query: 669 VKMTPGLTALTLIPFGASSRATQRVN*SSAALEMQYARMLGNDRNPATLETFTIL 505
           + +  GL   TL         T ++   S +   +  +   N R P+ LETF  L
Sbjct: 209 ISVVSGLHEATLTDLALGENYTVQIMAKSESSPFESLKKSLNFRTPSCLETFHTL 263


>AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory receptor
           candidate 51 protein.
          Length = 771

 Score = 21.4 bits (43), Expect = 7.1
 Identities = 12/35 (34%), Positives = 17/35 (48%)
 Frame = +3

Query: 129 RVQALVSVPKQL*TSQN*KQTWY*LQEIKRTWKKL 233
           +V+A+ + PK     Q   Q +  L E   TW KL
Sbjct: 598 KVEAIKTSPKMRHELQKLAQVYRILGETIETWNKL 632


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 142,351
Number of Sequences: 336
Number of extensions: 2896
Number of successful extensions: 7
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 17906060
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -