BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10f23 (545 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC651.01c |nog1|SPBC725.18c|GTP binding protein Nog1 |Schizosa... 26 3.2 SPBC13G1.05 |||DUF747 family protein|Schizosaccharomyces pombe|c... 26 4.2 SPAC1610.03c |crp79|meu5|poly|Schizosaccharomyces pombe|chr 1|||... 25 5.5 SPCC1739.12 |ppe1|esp1, ppx1|serine/threonine protein phosphatas... 25 7.3 SPAC1687.15 |gsk3|skp1|serine/threonine protein kinase Gsk3|Schi... 25 7.3 SPAC3H1.11 |hsr1||transcription factor Hsr1|Schizosaccharomyces ... 25 9.6 SPAC4H3.03c |||glucan 1,4-alpha-glucosidase |Schizosaccharomyces... 25 9.6 SPAC22E12.04 |ccs1|pccs, pccs|metallochaperone Ccs1 |Schizosacch... 25 9.6 >SPBC651.01c |nog1|SPBC725.18c|GTP binding protein Nog1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 642 Score = 26.2 bits (55), Expect = 3.2 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 251 GAVYLTLTACELAVAARVTTKLRNS 177 G + + TACE +AARV KL+ S Sbjct: 328 GVMDVRTTACEALLAARVEQKLKGS 352 >SPBC13G1.05 |||DUF747 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 649 Score = 25.8 bits (54), Expect = 4.2 Identities = 21/80 (26%), Positives = 37/80 (46%) Frame = -3 Query: 327 PDKADGRELGHPYFPGSDGPDASTGRRRVPHVDSLRAGCRSTSHNEAP*QSIIWSNTADC 148 P+K DG + P + PD + VP S A + +S +E P +S ++T+ Sbjct: 27 PNKRDGGKDNESVIPEKEEPDLNEPVLAVPLPKSRYALTKRSSSSEYPRRS---ASTSAK 83 Query: 147 QTVCSASRAGVSHFISRHGD 88 + V +R+ + F S+ D Sbjct: 84 KNVIPITRSYSTTFFSKTND 103 >SPAC1610.03c |crp79|meu5|poly|Schizosaccharomyces pombe|chr 1|||Manual Length = 710 Score = 25.4 bits (53), Expect = 5.5 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +1 Query: 421 SSVQPSNTYASVCDSVVLQYYSLLMDLYS 507 S + PSN Y D V+ S L DL+S Sbjct: 377 SPIDPSNLYVKNLDDTVITCKSQLEDLFS 405 >SPCC1739.12 |ppe1|esp1, ppx1|serine/threonine protein phosphatase Ppe1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 305 Score = 25.0 bits (52), Expect = 7.3 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 Query: 421 SSVQPSNTYASVCDSVVLQYYSLL 492 S++QP T +VC + Q+Y LL Sbjct: 37 SNIQPVRTPVTVCGDIHGQFYDLL 60 >SPAC1687.15 |gsk3|skp1|serine/threonine protein kinase Gsk3|Schizosaccharomyces pombe|chr 1|||Manual Length = 387 Score = 25.0 bits (52), Expect = 7.3 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -3 Query: 303 LGHPYFPGSDGPD 265 LGHP FPG G D Sbjct: 228 LGHPLFPGESGID 240 >SPAC3H1.11 |hsr1||transcription factor Hsr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 582 Score = 24.6 bits (51), Expect = 9.6 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -3 Query: 237 HVDSLRAGCRSTSHNEAP*QSIIWS 163 +V+S G STS+N+ P QS+ S Sbjct: 336 NVNSYNGGIPSTSYNDTPQQSVTGS 360 >SPAC4H3.03c |||glucan 1,4-alpha-glucosidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 649 Score = 24.6 bits (51), Expect = 9.6 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +1 Query: 481 YSLLMDLYSRLLIKFYLYEKK 543 + L +D+Y L+ Y+Y+KK Sbjct: 381 HHLQLDIYGELMDSIYIYDKK 401 >SPAC22E12.04 |ccs1|pccs, pccs|metallochaperone Ccs1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 297 Score = 24.6 bits (51), Expect = 9.6 Identities = 12/47 (25%), Positives = 19/47 (40%), Gaps = 1/47 (2%) Frame = +3 Query: 201 SCCDSQLAGC-QREVHGACR*TRQGRPSPGSRGVPVRDRPPCRGRGR 338 SCC S+ C +E G C + S + ++P C G+ Sbjct: 246 SCCSSKKPSCCSQEKKGCCSTEKTSCCSQEKKSCCTSEKPSCCSNGK 292 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,937,365 Number of Sequences: 5004 Number of extensions: 35235 Number of successful extensions: 91 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 90 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 91 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 225926624 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -