BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10f19 (279 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC4F11.04c |||mannosyltransferase complex subunit |Schizosacch... 26 1.1 SPAC8C9.15c |tif225||translation initiation factor eIF2B epsilon... 25 2.6 SPCC1919.13c |||conserved eukaryotic protein|Schizosaccharomyces... 24 3.5 SPCC970.09 |sec8||exocyst complex subunit Sec8|Schizosaccharomyc... 24 4.6 SPAC1610.03c |crp79|meu5|poly|Schizosaccharomyces pombe|chr 1|||... 23 8.0 SPAC13A11.04c |ubp8||ubiquitin C-terminal hydrolase Ubp8|Schizos... 23 8.0 SPCC584.14 |mug160||conserved eukaryotic protein|Schizosaccharom... 23 8.0 >SPCC4F11.04c |||mannosyltransferase complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 345 Score = 25.8 bits (54), Expect = 1.1 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -2 Query: 236 HIRCILCRTYPFSTIKLHNVHKKSNYNNNKTTI 138 HIR +L R Y FS ++ S+++NN I Sbjct: 256 HIRVLLERDYKFSNDSYFTFYEGSSWHNNDAGI 288 >SPAC8C9.15c |tif225||translation initiation factor eIF2B epsilon subunit|Schizosaccharomyces pombe|chr 1|||Manual Length = 678 Score = 24.6 bits (51), Expect = 2.6 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = -3 Query: 91 PMLNGLTFSFFAKIENKVTIGKRC 20 P+L LTFS +++N +T+ K C Sbjct: 585 PLLAKLTFSHEEQVDNVLTLQKYC 608 >SPCC1919.13c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 282 Score = 24.2 bits (50), Expect = 3.5 Identities = 13/44 (29%), Positives = 19/44 (43%) Frame = -2 Query: 275 FFNEQNFLMINKRHIRCILCRTYPFSTIKLHNVHKKSNYNNNKT 144 FF FL+ K I L T P++ L + K + Y + T Sbjct: 168 FFKASKFLLSEKGVIVITLAETKPYTLWNLKGLAKDAGYTSLMT 211 >SPCC970.09 |sec8||exocyst complex subunit Sec8|Schizosaccharomyces pombe|chr 3|||Manual Length = 1088 Score = 23.8 bits (49), Expect = 4.6 Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = -3 Query: 169 NQTIITIKLQLEQCFS--YN*LLIAYFKPMLNGLTFSFFAKIEN 44 N TI+T L+LE C + + +++ +S F KIE+ Sbjct: 931 NSTIVTTNLKLETCLNEWERRFVFQGLSELVDSSLYSIFYKIES 974 >SPAC1610.03c |crp79|meu5|poly|Schizosaccharomyces pombe|chr 1|||Manual Length = 710 Score = 23.0 bits (47), Expect = 8.0 Identities = 11/21 (52%), Positives = 14/21 (66%), Gaps = 2/21 (9%) Frame = -3 Query: 178 YIRN--QTIITIKLQLEQCFS 122 Y++N T+IT K QLE FS Sbjct: 385 YVKNLDDTVITCKSQLEDLFS 405 >SPAC13A11.04c |ubp8||ubiquitin C-terminal hydrolase Ubp8|Schizosaccharomyces pombe|chr 1|||Manual Length = 449 Score = 23.0 bits (47), Expect = 8.0 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 Query: 248 INKRHIRCILCRT 210 INKR IRC+ C + Sbjct: 44 INKRSIRCLSCHS 56 >SPCC584.14 |mug160||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 431 Score = 23.0 bits (47), Expect = 8.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 Query: 203 MDTFYRGYIGYGVC*SLKN 259 +D YR Y+ Y SLKN Sbjct: 247 VDLLYRDYVSYDTTISLKN 265 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,063,325 Number of Sequences: 5004 Number of extensions: 16483 Number of successful extensions: 42 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 2,362,478 effective HSP length: 62 effective length of database: 2,052,230 effective search space used: 61566900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -