BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10f18 (746 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g51050.1 68416.m05590 FG-GAP repeat-containing protein 30 1.4 At2g03070.1 68415.m00260 expressed protein 28 5.7 At4g21300.1 68417.m03077 pentatricopeptide (PPR) repeat-containi... 28 7.6 At5g18700.1 68418.m02219 protein kinase-related contains protein... 27 10.0 At1g78960.1 68414.m09206 lupeol synthase, putative / 2,3-oxidosq... 27 10.0 At1g67120.1 68414.m07636 midasin-related similar to Midasin (MID... 27 10.0 >At3g51050.1 68416.m05590 FG-GAP repeat-containing protein Length = 698 Score = 30.3 bits (65), Expect = 1.4 Identities = 25/78 (32%), Positives = 34/78 (43%), Gaps = 2/78 (2%) Frame = +3 Query: 516 CWASVPDNNR-QESSFNVTPLGHCCXIFLHHGVQYLRQTAGE*EAANSSPT*KPDQGRLI 692 CWA +E FNV+ H FLH+G Y R A A + T + LI Sbjct: 462 CWAVATSGVPIREQLFNVSICHHSPFNFLHYGGDYSRHFA----QARDTSTLEIATPILI 517 Query: 693 HR-SSHNGRQETHSDLIY 743 R H R+ +H D+I+ Sbjct: 518 PRDDGHKHRKGSHGDVIF 535 >At2g03070.1 68415.m00260 expressed protein Length = 524 Score = 28.3 bits (60), Expect = 5.7 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 64 PNFDKMTKPIPYNTFPK 114 PNFD T P+PY+ P+ Sbjct: 268 PNFDNTTSPLPYSNSPR 284 >At4g21300.1 68417.m03077 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 857 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 162 VSSTCHVNPLFPGVRFFR 109 +SS CHV + GVRFFR Sbjct: 651 ISSCCHVGDVDEGVRFFR 668 >At5g18700.1 68418.m02219 protein kinase-related contains protein kinase domain, INTERPRO:IPR000719 Length = 1366 Score = 27.5 bits (58), Expect = 10.0 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 112 KEPNAREQWIDVTGRGNWKQRLS 180 K+P R QW D+ G WK +++ Sbjct: 236 KDPAQRIQWADLCGHAFWKSKIN 258 >At1g78960.1 68414.m09206 lupeol synthase, putative / 2,3-oxidosqualene-triterpenoid cyclase, putative similar to lupeol synthase GI:1762150 from [Arabidopsis thaliana], 2,3-oxidosqualene-triterpenoid cyclase [Arabidopsis thaliana] GI:2738027 Length = 763 Score = 27.5 bits (58), Expect = 10.0 Identities = 11/33 (33%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +3 Query: 321 YQYLTRPA-VLGDAPHQWDRSRASDDSNKCCMV 416 Y+++++ A L D H W S + ++ KCCM+ Sbjct: 465 YRHISKGAWTLSDRDHGWQVSDCTAEALKCCML 497 >At1g67120.1 68414.m07636 midasin-related similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q12019) [Saccharomyces cerevisiae]; similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q9NU22) [Homo sapiens]; contains Prosite PS00017: ATP/GTP-binding site motif A (P-loop) Length = 5336 Score = 27.5 bits (58), Expect = 10.0 Identities = 16/62 (25%), Positives = 31/62 (50%), Gaps = 7/62 (11%) Frame = +1 Query: 40 LSVRIQNIPNFDKMTKPIPYNTFPKEPNAREQWIDVTGRGN-------WKQRLSSTSSLG 198 +++ + N+ N + +T +P FP+ ++ Q V N WK+R+ +S LG Sbjct: 4829 MNLMMTNMANGETLTDNLPKMEFPQNQSSTAQQTKVNPYRNVGDALKEWKERVRISSDLG 4888 Query: 199 KK 204 +K Sbjct: 4889 EK 4890 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,675,837 Number of Sequences: 28952 Number of extensions: 345052 Number of successful extensions: 914 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 894 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 914 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1653386488 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -