BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10f12 (703 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 25 0.92 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 23 2.1 AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 23 2.8 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 8.6 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 8.6 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 24.6 bits (51), Expect = 0.92 Identities = 13/69 (18%), Positives = 29/69 (42%) Frame = +2 Query: 473 VKTHFVSILDCKAMQAVYTKDTVPNRITSPQRILNETLNSFQTSDDQVTLEATTKSLVIK 652 VK H + +DC Y + + P +++ + + ++D+ T T+S + Sbjct: 955 VKKHITTTIDCSTQSEYYELEVKDQKNGKPPSVVSRSTQT-SANNDKDTNAVVTQSKEAR 1013 Query: 653 NYIDSNMDL 679 + I + L Sbjct: 1014 DNITATKQL 1022 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 23.4 bits (48), Expect = 2.1 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +3 Query: 180 EMNYTWSHYPTVY 218 E+ Y WSH+P V+ Sbjct: 110 EIYYIWSHFPYVF 122 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 23.0 bits (47), Expect = 2.8 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +2 Query: 449 CLKCKHGIVKTHFVSILDC 505 C KCK+GI + I+ C Sbjct: 43 CHKCKYGIAMSSACGIVQC 61 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 231 NVLNNIQSGNDSRYNS 184 N+L NI GN YN+ Sbjct: 360 NILGNIIEGNADSYNT 375 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 231 NVLNNIQSGNDSRYNS 184 N+L NI GN YN+ Sbjct: 360 NILGNIIEGNADSYNT 375 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,212 Number of Sequences: 438 Number of extensions: 3640 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -