BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10f11 (687 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholi... 29 0.055 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 29 0.055 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 22 6.3 >DQ026036-1|AAY87895.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 28.7 bits (61), Expect = 0.055 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +3 Query: 201 RYSCIWSVSSHISYCRFFGEHSFEKSFIKTSRSYRCLYI-HTSIIPSNICSIH 356 R S + S +S C FG SF++T + Y HT II ++C H Sbjct: 2 RASSVLQAESDVSSCVIFGVLFVLFSFLRTRTKLQPTYFHHTYIIYESLCGRH 54 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 28.7 bits (61), Expect = 0.055 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = +3 Query: 201 RYSCIWSVSSHISYCRFFGEHSFEKSFIKTSRSYRCLYI-HTSIIPSNICSIH 356 R S + S +S C FG SF++T + Y HT II ++C H Sbjct: 2 RASSVLQAESDVSSCVIFGVLFVLFSFLRTRTKLQPTYFHHTYIIYESLCGRH 54 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 21.8 bits (44), Expect = 6.3 Identities = 12/51 (23%), Positives = 23/51 (45%) Frame = +1 Query: 448 TKKKVLYLSLCKASIGLITMLYPLFIKFTITQYGFRGTLAIICAISAHSIF 600 T K ++ + C+A+ + + YP + I Y RG + +S I+ Sbjct: 19 TAKAIIGVDECQATPVIHFLQYPGCVPKPIPSYACRGRCSSYLQVSGSKIW 69 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,699 Number of Sequences: 438 Number of extensions: 4038 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20952180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -