BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10e23 (673 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 1.5 DQ485318-1|ABF21077.1| 223|Apis mellifera icarapin variant 1 pr... 23 3.5 AY939856-1|AAX33236.1| 223|Apis mellifera venom carbohydrate-ri... 23 3.5 AY897570-1|AAW81036.1| 223|Apis mellifera venom protein 2 protein. 23 3.5 DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. 22 6.1 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 6.1 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 8.1 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 8.1 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 21 8.1 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.8 bits (49), Expect = 1.5 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -2 Query: 639 SCGNGASTVSTPSRDSEDL 583 SCG G + ++TP DS+ + Sbjct: 369 SCGGGPTILTTPGLDSDGI 387 >DQ485318-1|ABF21077.1| 223|Apis mellifera icarapin variant 1 precursor protein. Length = 223 Score = 22.6 bits (46), Expect = 3.5 Identities = 20/103 (19%), Positives = 43/103 (41%), Gaps = 1/103 (0%) Frame = +2 Query: 173 IDTEFSSIRERFDAEMRKMEEEMSKFRSELMNRESNNFFKXXXXXXXXXQHSDSRQLAEP 352 +D + +++ A M+K+ E+M+ S + + N+ K ++ S Sbjct: 81 LDGWYQTLQSAISAHMKKVREQMAGILSRIPEQGVVNWNK-----IPEGANTTSTTKIID 135 Query: 353 SHWDSLNSPLIQDEGDGKTLKLRFDVSQYTPE-EIVVKTVDNK 478 H ++N D D + +R V P+ E ++ TV ++ Sbjct: 136 GHVVTINETTYTDGSDDYSTLIRVRVIDVRPQNETILTTVSSE 178 >AY939856-1|AAX33236.1| 223|Apis mellifera venom carbohydrate-rich protein precursor protein. Length = 223 Score = 22.6 bits (46), Expect = 3.5 Identities = 20/103 (19%), Positives = 43/103 (41%), Gaps = 1/103 (0%) Frame = +2 Query: 173 IDTEFSSIRERFDAEMRKMEEEMSKFRSELMNRESNNFFKXXXXXXXXXQHSDSRQLAEP 352 +D + +++ A M+K+ E+M+ S + + N+ K ++ S Sbjct: 81 LDGWYQTLQSAISAHMKKVREQMAGILSRIPEQGVVNWNK-----IPEGANTTSTTKIID 135 Query: 353 SHWDSLNSPLIQDEGDGKTLKLRFDVSQYTPE-EIVVKTVDNK 478 H ++N D D + +R V P+ E ++ TV ++ Sbjct: 136 GHVVTINETTYTDGSDDYSTLIRVRVIDVRPQNETILTTVSSE 178 >AY897570-1|AAW81036.1| 223|Apis mellifera venom protein 2 protein. Length = 223 Score = 22.6 bits (46), Expect = 3.5 Identities = 20/103 (19%), Positives = 43/103 (41%), Gaps = 1/103 (0%) Frame = +2 Query: 173 IDTEFSSIRERFDAEMRKMEEEMSKFRSELMNRESNNFFKXXXXXXXXXQHSDSRQLAEP 352 +D + +++ A M+K+ E+M+ S + + N+ K ++ S Sbjct: 81 LDGWYQTLQSAISAHMKKVREQMAGILSRIPEQGVVNWNK-----IPEGANTTSTTKIID 135 Query: 353 SHWDSLNSPLIQDEGDGKTLKLRFDVSQYTPE-EIVVKTVDNK 478 H ++N D D + +R V P+ E ++ TV ++ Sbjct: 136 GHVVAINETTYTDGSDDYSTLIRVRVIDVRPQNETILTTVSSE 178 >DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. Length = 120 Score = 21.8 bits (44), Expect = 6.1 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 657 SCPVMASCGNGASTV 613 +CP+ +CG+ A TV Sbjct: 74 TCPICGACGDIAHTV 88 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.8 bits (44), Expect = 6.1 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -1 Query: 478 FVVDSLNNDLF 446 F+VD L NDLF Sbjct: 96 FIVDRLRNDLF 106 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.4 bits (43), Expect = 8.1 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = +2 Query: 443 PEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKG 565 P+E+ + N+L+V E S + LLPKG Sbjct: 567 PDEVPSDVLYNRLVVSEDGSETFKYSSQPYGFPERLLLPKG 607 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.4 bits (43), Expect = 8.1 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = +2 Query: 443 PEEIVVKTVDNKLLVHAKHEEKSDTKSVYREYNREFLLPKG 565 P+E+ + N+L+V E S + LLPKG Sbjct: 567 PDEVPSDVLYNRLVVSEDGSETFKYSSQPYGFPERLLLPKG 607 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 21.4 bits (43), Expect = 8.1 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -2 Query: 138 LLRPLSAIFHVICRVEIVETKQTLKRSRVNTF 43 L PL+ I H C I T+ + +R N F Sbjct: 287 LEEPLTTIQHNNCLTRIPSTRINKQHTRGNNF 318 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,414 Number of Sequences: 438 Number of extensions: 3562 Number of successful extensions: 18 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20343105 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -