BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10e21 (729 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014296-740|AAF47825.3| 353|Drosophila melanogaster CG14987-PA... 30 3.7 AE014296-739|AAS64968.1| 429|Drosophila melanogaster CG14987-PB... 30 3.7 >AE014296-740|AAF47825.3| 353|Drosophila melanogaster CG14987-PA, isoform A protein. Length = 353 Score = 29.9 bits (64), Expect = 3.7 Identities = 20/54 (37%), Positives = 22/54 (40%) Frame = -1 Query: 357 NPGLYQYPHLLLSFGFSCPFSLGSFCHLFQASFFPWPLIFLTSCLPSPIFFPAC 196 N GL Y LSF C F GSF L + WP I + L IF C Sbjct: 9 NDGLQLYTMGSLSFSVICIFCFGSFIKLSRR----WPHIIRETALCERIFLKPC 58 >AE014296-739|AAS64968.1| 429|Drosophila melanogaster CG14987-PB protein. Length = 429 Score = 29.9 bits (64), Expect = 3.7 Identities = 20/54 (37%), Positives = 22/54 (40%) Frame = -1 Query: 357 NPGLYQYPHLLLSFGFSCPFSLGSFCHLFQASFFPWPLIFLTSCLPSPIFFPAC 196 N GL Y LSF C F GSF L + WP I + L IF C Sbjct: 85 NDGLQLYTMGSLSFSVICIFCFGSFIKLSRR----WPHIIRETALCERIFLKPC 134 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,891,521 Number of Sequences: 53049 Number of extensions: 328545 Number of successful extensions: 944 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 893 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 942 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3273062859 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -