BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10e13 (554 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC8C9.06c |||mitochondrial translation regulator |Schizosaccha... 26 4.3 SPCC1620.07c |||lunapark homolog|Schizosaccharomyces pombe|chr 3... 25 7.5 >SPAC8C9.06c |||mitochondrial translation regulator |Schizosaccharomyces pombe|chr 1|||Manual Length = 931 Score = 25.8 bits (54), Expect = 4.3 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -1 Query: 437 CYIFSSMFEYRILSGRCYRC 378 CY+FSS F Y+ S R Y C Sbjct: 152 CYLFSSYFSYK--SSRQYTC 169 >SPCC1620.07c |||lunapark homolog|Schizosaccharomyces pombe|chr 3|||Manual Length = 334 Score = 25.0 bits (52), Expect = 7.5 Identities = 12/47 (25%), Positives = 23/47 (48%) Frame = +2 Query: 41 NKNGLESDYCFMHHASSSFGCPSTCHRWCRRLGRLEQWRSQPLDTSM 181 N+ L +CF H+ +S+G ++ R+ + W P+D S+ Sbjct: 195 NREALICSHCFHHNGLASYGEKASDVRYVCLF--CKAWNGPPIDKSL 239 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,083,104 Number of Sequences: 5004 Number of extensions: 40175 Number of successful extensions: 112 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 231978230 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -