BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10e10 (498 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value S76959-1|AAB33934.1| 85|Apis mellifera olfactory receptor prot... 23 1.3 AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-act... 23 1.8 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 23 1.8 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 23 1.8 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 23 2.3 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 3.1 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 21 7.1 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 21 9.4 >S76959-1|AAB33934.1| 85|Apis mellifera olfactory receptor protein. Length = 85 Score = 23.4 bits (48), Expect = 1.3 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -3 Query: 82 WAEVDGMCYSYDAHILVVILLREFGMV 2 W + G C S HI++V L EFG++ Sbjct: 46 WFKAIGTCGS---HIIIVGLFYEFGLI 69 >AY739659-1|AAU85298.1| 288|Apis mellifera hyperpolarization-activated ion channelvariant T protein. Length = 288 Score = 23.0 bits (47), Expect = 1.8 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -1 Query: 108 WIIAPCWMFGPKWMACVTRTMLTSL 34 W+I PC F W C+ ++ +L Sbjct: 79 WVIHPCSSFRFYWDLCMLLLLVANL 103 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 23.0 bits (47), Expect = 1.8 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -1 Query: 108 WIIAPCWMFGPKWMACVTRTMLTSL 34 W+I PC F W C+ ++ +L Sbjct: 79 WVIHPCSSFRFYWDLCMLLLLVANL 103 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 23.0 bits (47), Expect = 1.8 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -1 Query: 108 WIIAPCWMFGPKWMACVTRTMLTSL 34 W+I PC F W C+ ++ +L Sbjct: 79 WVIHPCSSFRFYWDLCMLLLLVANL 103 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.6 bits (46), Expect = 2.3 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +1 Query: 55 SNTCHPLRPKHPAGCYYPTRCRNTPGYF 138 S++C + Y T CR PGYF Sbjct: 276 SHSCEACPAHSKSSDYGFTECRCDPGYF 303 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 22.2 bits (45), Expect = 3.1 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -2 Query: 347 QGHPSQYCRSRGHQP 303 Q HPSQY RG P Sbjct: 320 QHHPSQYHPHRGSSP 334 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 21.0 bits (42), Expect = 7.1 Identities = 10/35 (28%), Positives = 15/35 (42%) Frame = -2 Query: 404 HWHCSFQKIRCLLAHFGRRQGHPSQYCRSRGHQPG 300 +W C+ +K G+ +GH R RG G Sbjct: 65 YWQCNDKKTDIEETGRGKGRGHGKGGSRGRGGNRG 99 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 20.6 bits (41), Expect = 9.4 Identities = 9/21 (42%), Positives = 9/21 (42%) Frame = -2 Query: 356 GRRQGHPSQYCRSRGHQPGPN 294 G R PS GH P PN Sbjct: 109 GYRSASPSPGMGHMGHTPTPN 129 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,000 Number of Sequences: 438 Number of extensions: 3373 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -