BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10e05 (717 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 24 1.7 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 2.9 DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein ... 22 5.0 AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein ... 22 5.0 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 8.8 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 8.8 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 8.8 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 8.8 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 8.8 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 8.8 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 8.8 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 23.8 bits (49), Expect = 1.7 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -2 Query: 296 NGFPSSSLYAPTPRFTFLGCVSFLYASVM 210 N P S Y FLGC FL+A+++ Sbjct: 283 NSLPKVS-YIKASEIWFLGCTIFLFAAMV 310 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 183 DGSARCNLRHYRSIQEG 233 DG AR N+ H++ I+ G Sbjct: 535 DGPARYNIIHFKQIEPG 551 >DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein 6 protein. Length = 125 Score = 22.2 bits (45), Expect = 5.0 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -2 Query: 62 KLSNTGKIITNYVVLLKDE 6 ++ G+I+TNY+ + DE Sbjct: 32 RILQNGRILTNYIKCMLDE 50 >AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein protein. Length = 125 Score = 22.2 bits (45), Expect = 5.0 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -2 Query: 62 KLSNTGKIITNYVVLLKDE 6 ++ G+I+TNY+ + DE Sbjct: 32 RILQNGRILTNYIKCMLDE 50 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 8.8 Identities = 12/48 (25%), Positives = 20/48 (41%) Frame = -1 Query: 567 VVSPSRRREPDLLCLSVVFRYELESESECASAGQCLYSTVAPIFDDRT 424 ++ R RE + L ++ YEL E G + +P DR+ Sbjct: 44 LIQQEREREHERLMKKMILEYELRRIREIEKLGSERSKSRSPDSRDRS 91 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 8.8 Identities = 12/48 (25%), Positives = 20/48 (41%) Frame = -1 Query: 567 VVSPSRRREPDLLCLSVVFRYELESESECASAGQCLYSTVAPIFDDRT 424 ++ R RE + L ++ YEL E G + +P DR+ Sbjct: 44 LIQQEREREHERLMKKMILEYELRRIREIEKLGSERSKSRSPDSRDRS 91 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 8.8 Identities = 12/48 (25%), Positives = 20/48 (41%) Frame = -1 Query: 567 VVSPSRRREPDLLCLSVVFRYELESESECASAGQCLYSTVAPIFDDRT 424 ++ R RE + L ++ YEL E G + +P DR+ Sbjct: 44 LIQQEREREHERLMKKMILEYELRRIREIEKLGSERSKSRSPDSRDRS 91 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 8.8 Identities = 12/48 (25%), Positives = 20/48 (41%) Frame = -1 Query: 567 VVSPSRRREPDLLCLSVVFRYELESESECASAGQCLYSTVAPIFDDRT 424 ++ R RE + L ++ YEL E G + +P DR+ Sbjct: 44 LIQQEREREHERLMKKMILEYELRRIREIEKLGSERSKSRSPDSRDRS 91 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 8.8 Identities = 12/48 (25%), Positives = 20/48 (41%) Frame = -1 Query: 567 VVSPSRRREPDLLCLSVVFRYELESESECASAGQCLYSTVAPIFDDRT 424 ++ R RE + L ++ YEL E G + +P DR+ Sbjct: 44 LIQQEREREHERLMKKMILEYELRRIREIEKLGSERSKSRSPDSRDRS 91 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 8.8 Identities = 12/48 (25%), Positives = 20/48 (41%) Frame = -1 Query: 567 VVSPSRRREPDLLCLSVVFRYELESESECASAGQCLYSTVAPIFDDRT 424 ++ R RE + L ++ YEL E G + +P DR+ Sbjct: 44 LIQQEREREHERLMKKMILEYELRRIREIEKLGSERSKSRSPDSRDRS 91 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.4 bits (43), Expect = 8.8 Identities = 12/48 (25%), Positives = 20/48 (41%) Frame = -1 Query: 567 VVSPSRRREPDLLCLSVVFRYELESESECASAGQCLYSTVAPIFDDRT 424 ++ R RE + L ++ YEL E G + +P DR+ Sbjct: 44 LIQQEREREHERLMKKMILEYELRRIREIEKLGSERSKSRSPDSRDRS 91 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 216,896 Number of Sequences: 438 Number of extensions: 4753 Number of successful extensions: 32 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22170330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -