BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10e04 (295 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC020961-1|AAH20961.1| 495|Homo sapiens solute carrier family 1... 32 0.29 AL590428-1|CAI15635.1| 495|Homo sapiens solute carrier family 1... 32 0.29 AL121972-1|CAI20417.1| 495|Homo sapiens solute carrier family 1... 32 0.29 AJ387747-1|CAB62540.1| 495|Homo sapiens sialin protein. 32 0.29 AF244577-1|AAF97769.1| 536|Homo sapiens membrane glycoprotein H... 32 0.29 BC069646-1|AAH69646.1| 582|Homo sapiens differentiation-associa... 31 0.51 BC069640-1|AAH69640.1| 582|Homo sapiens solute carrier family 1... 31 0.51 BC069629-1|AAH69629.1| 582|Homo sapiens solute carrier family 1... 31 0.51 AB032435-1|BAA92874.1| 582|Homo sapiens differentiation-associa... 31 0.51 BC072430-1|AAH72430.1| 272|Homo sapiens cholesterol 25-hydroxyl... 28 4.7 BC059379-1|AAH59379.1| 560|Homo sapiens solute carrier family 1... 28 4.7 BC017843-1|AAH17843.1| 272|Homo sapiens cholesterol 25-hydroxyl... 28 4.7 AL513533-5|CAI13519.1| 272|Homo sapiens cholesterol 25-hydroxyl... 28 4.7 AF059214-1|AAC97483.1| 272|Homo sapiens cholesterol 25-hydroxyl... 28 4.7 AF059212-1|AAC97481.1| 272|Homo sapiens cholesterol 25-hydroxyl... 28 4.7 AB032436-1|BAA92875.1| 560|Homo sapiens brain-specific Na-depen... 28 4.7 >BC020961-1|AAH20961.1| 495|Homo sapiens solute carrier family 17 (anion/sugar transporter), member 5 protein. Length = 495 Score = 32.3 bits (70), Expect = 0.29 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +3 Query: 33 WQIVFLITVSFQFITNAVFVIFVKGSVQPWNFHD 134 WQ VF I + F +F KG VQ W +D Sbjct: 456 WQTVFYIAAAINVFGAIFFTLFAKGEVQNWALND 489 >AL590428-1|CAI15635.1| 495|Homo sapiens solute carrier family 17 (anion/sugar transporter), member 5 protein. Length = 495 Score = 32.3 bits (70), Expect = 0.29 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +3 Query: 33 WQIVFLITVSFQFITNAVFVIFVKGSVQPWNFHD 134 WQ VF I + F +F KG VQ W +D Sbjct: 456 WQTVFYIAAAINVFGAIFFTLFAKGEVQNWALND 489 >AL121972-1|CAI20417.1| 495|Homo sapiens solute carrier family 17 (anion/sugar transporter), member 5 protein. Length = 495 Score = 32.3 bits (70), Expect = 0.29 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +3 Query: 33 WQIVFLITVSFQFITNAVFVIFVKGSVQPWNFHD 134 WQ VF I + F +F KG VQ W +D Sbjct: 456 WQTVFYIAAAINVFGAIFFTLFAKGEVQNWALND 489 >AJ387747-1|CAB62540.1| 495|Homo sapiens sialin protein. Length = 495 Score = 32.3 bits (70), Expect = 0.29 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +3 Query: 33 WQIVFLITVSFQFITNAVFVIFVKGSVQPWNFHD 134 WQ VF I + F +F KG VQ W +D Sbjct: 456 WQTVFYIAAAINVFGAIFFTLFAKGEVQNWALND 489 >AF244577-1|AAF97769.1| 536|Homo sapiens membrane glycoprotein HP59 protein. Length = 536 Score = 32.3 bits (70), Expect = 0.29 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +3 Query: 33 WQIVFLITVSFQFITNAVFVIFVKGSVQPWNFHD 134 WQ VF I + F +F KG VQ W +D Sbjct: 497 WQTVFYIAAAINVFGAIFFTLFAKGEVQNWALND 530 >BC069646-1|AAH69646.1| 582|Homo sapiens differentiation-associated Na-dependent inorganic phosphate cotr protein. Length = 582 Score = 31.5 bits (68), Expect = 0.51 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +3 Query: 18 KNPSR--WQIVFLITVSFQFITNAVFVIFVKGSVQPW 122 KN SR WQ VFLI + + IF G QPW Sbjct: 469 KNKSREEWQYVFLIAALVHYGGVIFYAIFASGEKQPW 505 >BC069640-1|AAH69640.1| 582|Homo sapiens solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), protein. Length = 582 Score = 31.5 bits (68), Expect = 0.51 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +3 Query: 18 KNPSR--WQIVFLITVSFQFITNAVFVIFVKGSVQPW 122 KN SR WQ VFLI + + IF G QPW Sbjct: 469 KNKSREEWQYVFLIAALVHYGGVIFYAIFASGEKQPW 505 >BC069629-1|AAH69629.1| 582|Homo sapiens solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), protein. Length = 582 Score = 31.5 bits (68), Expect = 0.51 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +3 Query: 18 KNPSR--WQIVFLITVSFQFITNAVFVIFVKGSVQPW 122 KN SR WQ VFLI + + IF G QPW Sbjct: 469 KNKSREEWQYVFLIAALVHYGGVIFYAIFASGEKQPW 505 >AB032435-1|BAA92874.1| 582|Homo sapiens differentiation-associated Na-dependent inorganic phosphate cotransporter protein. Length = 582 Score = 31.5 bits (68), Expect = 0.51 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +3 Query: 18 KNPSR--WQIVFLITVSFQFITNAVFVIFVKGSVQPW 122 KN SR WQ VFLI + + IF G QPW Sbjct: 469 KNKSREEWQYVFLIAALVHYGGVIFYAIFASGEKQPW 505 >BC072430-1|AAH72430.1| 272|Homo sapiens cholesterol 25-hydroxylase protein. Length = 272 Score = 28.3 bits (60), Expect = 4.7 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 128 KVPWLHRPFHEYHEDS 81 KVPWL+R FH+ H + Sbjct: 148 KVPWLYRTFHKVHHQN 163 >BC059379-1|AAH59379.1| 560|Homo sapiens solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), protein. Length = 560 Score = 28.3 bits (60), Expect = 4.7 Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 4/59 (6%) Frame = +3 Query: 18 KNPSRWQIVFLITVSFQFITNAVFVIFVKGSVQPW---NFHDEERIG-TGVEELKSLND 182 K WQ VFLI + + +F G QPW EE+ G G ++L +D Sbjct: 463 KTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDD 521 >BC017843-1|AAH17843.1| 272|Homo sapiens cholesterol 25-hydroxylase protein. Length = 272 Score = 28.3 bits (60), Expect = 4.7 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 128 KVPWLHRPFHEYHEDS 81 KVPWL+R FH+ H + Sbjct: 148 KVPWLYRTFHKVHHQN 163 >AL513533-5|CAI13519.1| 272|Homo sapiens cholesterol 25-hydroxylase protein. Length = 272 Score = 28.3 bits (60), Expect = 4.7 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 128 KVPWLHRPFHEYHEDS 81 KVPWL+R FH+ H + Sbjct: 148 KVPWLYRTFHKVHHQN 163 >AF059214-1|AAC97483.1| 272|Homo sapiens cholesterol 25-hydroxylase protein. Length = 272 Score = 28.3 bits (60), Expect = 4.7 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 128 KVPWLHRPFHEYHEDS 81 KVPWL+R FH+ H + Sbjct: 148 KVPWLYRTFHKVHHQN 163 >AF059212-1|AAC97481.1| 272|Homo sapiens cholesterol 25-hydroxylase protein. Length = 272 Score = 28.3 bits (60), Expect = 4.7 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 128 KVPWLHRPFHEYHEDS 81 KVPWL+R FH+ H + Sbjct: 148 KVPWLYRTFHKVHHQN 163 >AB032436-1|BAA92875.1| 560|Homo sapiens brain-specific Na-dependent inorganic phosphate cotransporter protein. Length = 560 Score = 28.3 bits (60), Expect = 4.7 Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 4/59 (6%) Frame = +3 Query: 18 KNPSRWQIVFLITVSFQFITNAVFVIFVKGSVQPW---NFHDEERIG-TGVEELKSLND 182 K WQ VFLI + + +F G QPW EE+ G G ++L +D Sbjct: 463 KTREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDD 521 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,589,591 Number of Sequences: 237096 Number of extensions: 507889 Number of successful extensions: 1090 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 1077 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1090 length of database: 76,859,062 effective HSP length: 74 effective length of database: 59,313,958 effective search space used: 1364221034 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -