BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= bmmt10e02
(495 letters)
Database: tribolium
336 sequences; 122,585 total letters
Searching.......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 21 4.6
AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory recept... 21 6.1
AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 21 8.1
>AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor
candidate 38 protein.
Length = 436
Score = 21.4 bits (43), Expect = 4.6
Identities = 8/13 (61%), Positives = 11/13 (84%)
Frame = -1
Query: 318 YLYIIVIDPLVIY 280
YL I+I+PLV+Y
Sbjct: 138 YLLPIIINPLVLY 150
>AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory receptor
candidate 28 protein.
Length = 248
Score = 21.0 bits (42), Expect = 6.1
Identities = 10/32 (31%), Positives = 15/32 (46%)
Frame = -1
Query: 288 VIYLIPFTQFLFLMLSFLRFQEIENIVGCTGD 193
V + P LF+ +F+ Q EN +GD
Sbjct: 188 VYKVFPVEHLLFIANAFITSQSCENATLYSGD 219
>AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical
protein protein.
Length = 205
Score = 20.6 bits (41), Expect = 8.1
Identities = 6/11 (54%), Positives = 8/11 (72%)
Frame = -1
Query: 417 VHSCRCNQFKN 385
V +CRC +KN
Sbjct: 174 VFTCRCKDYKN 184
Database: tribolium
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 122,585
Number of sequences in database: 336
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 99,663
Number of Sequences: 336
Number of extensions: 1934
Number of successful extensions: 7
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 11630247
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)
- SilkBase 1999-2023 -