BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10e02 (495 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 21 4.6 AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory recept... 21 6.1 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 21 8.1 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 21.4 bits (43), Expect = 4.6 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -1 Query: 318 YLYIIVIDPLVIY 280 YL I+I+PLV+Y Sbjct: 138 YLLPIIINPLVLY 150 >AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory receptor candidate 28 protein. Length = 248 Score = 21.0 bits (42), Expect = 6.1 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -1 Query: 288 VIYLIPFTQFLFLMLSFLRFQEIENIVGCTGD 193 V + P LF+ +F+ Q EN +GD Sbjct: 188 VYKVFPVEHLLFIANAFITSQSCENATLYSGD 219 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 20.6 bits (41), Expect = 8.1 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = -1 Query: 417 VHSCRCNQFKN 385 V +CRC +KN Sbjct: 174 VFTCRCKDYKN 184 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,663 Number of Sequences: 336 Number of extensions: 1934 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11630247 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -