BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10d22 (633 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40870| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_13925| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_13958| Best HMM Match : K_tetra (HMM E-Value=7.00649e-45) 29 2.4 SB_39171| Best HMM Match : EzrA (HMM E-Value=0.16) 27 9.6 >SB_40870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 83.0 bits (196), Expect = 2e-16 Identities = 44/111 (39%), Positives = 65/111 (58%) Frame = +1 Query: 208 SIKMLLRTSRSAHVFRGVRAYSVLQHEPDKPNIQTAIPGPKSQQLLKELNTLQQAGAVQL 387 S++ L + R+ H+ R V S E + +++T++PGPKSQ + ++ Sbjct: 97 SLRRLSSSRRALHISRPVLVASFNIDEYEGIDMRTSVPGPKSQS----------SKGMKY 146 Query: 388 FADYDKSIGNYFFDADGNAFLDAFTQISSLPVGYNHPELLSAFEDQHNLKS 540 F D++KS GNY DADGN LD + QI+S+P+GYNHP LL A +D L S Sbjct: 147 FVDFEKSKGNYVVDADGNVMLDVYQQIASIPLGYNHPALLKAMQDPEILVS 197 >SB_13925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 317 Score = 32.7 bits (71), Expect = 0.25 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +1 Query: 424 FDADGNAFLDAFTQISSLPVGYNHPELLSAFEDQHNLKSLINR 552 +D G ++D S++ G+ HP ++ A +DQ + SL +R Sbjct: 2 WDVTGKRYIDFLAAYSAVNQGHCHPRIVKALQDQAGILSLTSR 44 >SB_13958| Best HMM Match : K_tetra (HMM E-Value=7.00649e-45) Length = 623 Score = 29.5 bits (63), Expect = 2.4 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = +1 Query: 397 YDKSIGNYFFDADGNAFLDAFTQISSLPVGYNHPELLSAFEDQ 525 YD YFFD D + F + + Y E +S+FED+ Sbjct: 73 YDAETKEYFFDRDPDLFRHLLNYYRNGKLHYPRGECVSSFEDE 115 >SB_39171| Best HMM Match : EzrA (HMM E-Value=0.16) Length = 587 Score = 27.5 bits (58), Expect = 9.6 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 6/62 (9%) Frame = -2 Query: 218 ILILRIKNFVDRTSRFCCTSKSNL*LGRYL-SMQQKFY-----YSPLSGTVRNNRVRLNI 57 ++ ++ K D T + CC ++++L LG L SM++KF+ S L GT+++N + Sbjct: 371 VMKMQQKQSRDLTFKMCCETQTDL-LGDELESMEEKFFNYEKENSLLRGTIKSNESLIGT 429 Query: 56 TE 51 E Sbjct: 430 LE 431 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,684,905 Number of Sequences: 59808 Number of extensions: 327108 Number of successful extensions: 676 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 674 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1584657875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -