BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10d17 (429 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ973476-1|CAJ01523.1| 126|Anopheles gambiae hypothetical prote... 26 0.65 AJ697729-1|CAG26922.1| 126|Anopheles gambiae putative sensory a... 26 0.65 AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 26 0.65 AY659931-1|AAT51799.1| 167|Anopheles gambiae lysozyme i-1 protein. 25 0.86 AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-b... 25 1.5 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 3.5 AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotens... 23 3.5 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 6.1 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 6.1 AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin bi... 22 8.0 AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin b... 22 8.0 >AJ973476-1|CAJ01523.1| 126|Anopheles gambiae hypothetical protein protein. Length = 126 Score = 25.8 bits (54), Expect = 0.65 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +1 Query: 49 MKFFMIFVLALLAMANAQD 105 MKFF++ LAL+A AQD Sbjct: 1 MKFFVVVALALVAAVAAQD 19 >AJ697729-1|CAG26922.1| 126|Anopheles gambiae putative sensory appendage protein SAP-3 protein. Length = 126 Score = 25.8 bits (54), Expect = 0.65 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +1 Query: 49 MKFFMIFVLALLAMANAQD 105 MKFF++ LAL+A AQD Sbjct: 1 MKFFVVVALALVAAVAAQD 19 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 25.8 bits (54), Expect = 0.65 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +3 Query: 171 HR*SSQRLQP*WKRLRTYRQRCILRGPSPRPTLLQA 278 +R ++++ WKR+RT R + + P P+L+ A Sbjct: 54 YRTCNRQINQQWKRIRTERLKTLEHSPEMPPSLIIA 89 >AY659931-1|AAT51799.1| 167|Anopheles gambiae lysozyme i-1 protein. Length = 167 Score = 25.4 bits (53), Expect = 0.86 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 64 IFVLALLAMANAQDPVKVVENADSGNGYEPIDNRPY 171 +F + A+A PV+ ++ DS N Y N PY Sbjct: 65 MFAITWAYWADAGKPVQQGDSPDSQNAYANCANEPY 100 >AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-binding protein OBPjj17 protein. Length = 285 Score = 24.6 bits (51), Expect = 1.5 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 Query: 196 NPNGNGYEPIDNGAYYV 246 N NGNGY D+G Y V Sbjct: 269 NRNGNGYGAGDDGGYVV 285 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.4 bits (48), Expect = 3.5 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +3 Query: 246 GPSPRPTLLQAYPFP 290 GP P PTL Q P P Sbjct: 71 GPQPDPTLEQGVPVP 85 >AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotensin converting enzymeprecursor protein. Length = 339 Score = 23.4 bits (48), Expect = 3.5 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 6/39 (15%) Frame = +1 Query: 157 DNRPYIVNPPKDY------NPNGNGYEPIDNGAYYVDPP 255 D PY NP +DY NPN Y P D +PP Sbjct: 183 DRTPY--NPSRDYDDRNRYNPNARPYNPNDPSFGGRNPP 219 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 22.6 bits (46), Expect = 6.1 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +1 Query: 334 NEIMY*QYISKFHMNLCQ 387 N Y +Y+SK NLC+ Sbjct: 448 NRFRYRRYLSKIQRNLCR 465 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 22.6 bits (46), Expect = 6.1 Identities = 23/75 (30%), Positives = 34/75 (45%), Gaps = 5/75 (6%) Frame = +2 Query: 131 TQETATNLLTTARTSLILPKITTLMETATNLSTTVHIT-WTLPK----ADLTSSLPLSLV 295 T + T TT LILPKI T + S T+ + W LPK AD T S+ Sbjct: 506 TIRSLTTEYTTCLEFLILPKIATDLP-----SETMDVRGWKLPKDVRLADPTFHERGSID 560 Query: 296 LAVGSKEYLRKLITK 340 + +G+ ++ + K Sbjct: 561 MLIGADTFVEMIKAK 575 >AJ441131-1|CAD29630.1| 567|Anopheles gambiae putative chitin binding protein protein. Length = 567 Score = 22.2 bits (45), Expect = 8.0 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +1 Query: 172 IVNPPKDYNPNGNGYEPIDNGAYYVDPP 255 ++N PK+Y P G DN VD P Sbjct: 349 VMNAPKEYYPVGYDKNFDDNFTSKVDLP 376 >AJ439060-17|CAD27768.1| 568|Anopheles gambiae putative chitin binding protein protein. Length = 568 Score = 22.2 bits (45), Expect = 8.0 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +1 Query: 172 IVNPPKDYNPNGNGYEPIDNGAYYVDPP 255 ++N PK+Y P G DN VD P Sbjct: 357 VMNAPKEYYPVGYDKNFDDNFTSKVDLP 384 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 433,293 Number of Sequences: 2352 Number of extensions: 9412 Number of successful extensions: 60 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 35292513 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -