BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10d17 (429 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 24 0.83 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 2.5 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 21 4.4 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 4.4 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 21 7.7 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 21 7.7 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 23.8 bits (49), Expect = 0.83 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = +2 Query: 176 LILPKITTLMETATNLSTTVHI-TWTLP 256 L+LPK+T +E L+ TV I TW P Sbjct: 518 LVLPKLTLEVEEWNPLTDTVPIHTWIHP 545 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 2.5 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +3 Query: 234 CILRGPSPRPTLLQA 278 C+LR +P P +L+A Sbjct: 1106 CVLRASTPAPVVLEA 1120 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 21.4 bits (43), Expect = 4.4 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = +3 Query: 249 PSPRPTLLQAYPFPWCSRWEVKNILE 326 P P+P L + YP ++ ++ IL+ Sbjct: 31 PRPKPLLKKEYPLVMDTKLKIIEILQ 56 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.4 bits (43), Expect = 4.4 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = +1 Query: 73 LALLAMANAQDPVKVVENADSGNGYEPIDNRPY 171 L L M P+ +V+N +S I N P+ Sbjct: 297 LTLAKMEKTSKPLPMVDNPESTGNLVYIYNNPF 329 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 20.6 bits (41), Expect = 7.7 Identities = 12/43 (27%), Positives = 17/43 (39%) Frame = +1 Query: 157 DNRPYIVNPPKDYNPNGNGYEPIDNGAYYVDPPQGRPYFKPTP 285 +N Y N +YN N N Y Y ++ + P P P Sbjct: 92 NNNNYNNNNYNNYNYNNNNYNNYKKLYYNINYIEQIPVPVPVP 134 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 20.6 bits (41), Expect = 7.7 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = -3 Query: 268 KVGLGEGPRNMH 233 K GLG+GPR + Sbjct: 562 KTGLGKGPRTTY 573 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,603 Number of Sequences: 438 Number of extensions: 2839 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 11121030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -