BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10d15 (616 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 22 5.5 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 21 7.2 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 9.6 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 9.6 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.8 bits (44), Expect = 5.5 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -1 Query: 163 NACLYAAAVANVRT*LPWLEITLKVVATFN 74 NA AA V PW+ +TL V+A N Sbjct: 47 NATACAALYERVEWSGPWILVTLIVLAIVN 76 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.4 bits (43), Expect = 7.2 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = +2 Query: 14 LRKSARKKYFNS*YKDHNKNVESSNH 91 +R+ +R+K + Y N +V +NH Sbjct: 261 VRRDSRRKNYGGVYHLDNHHVHHANH 286 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.0 bits (42), Expect = 9.6 Identities = 15/74 (20%), Positives = 32/74 (43%), Gaps = 1/74 (1%) Frame = +3 Query: 18 VNRQGKNILTHSIKITTKMLKVATTLRVI-SSQGNQVRTLATAAAYKQALVNVPPTKLTV 194 +NRQGK ++ ++ ++ + ++I S+Q Q A A + P L Sbjct: 1150 LNRQGKQVIQTQYQVVSQAQTSSGQSKIIASTQQQQQSQQAQTVRMVTAQLAGKPIVLAS 1209 Query: 195 LDNGLRIATEDSGA 236 + + + +SG+ Sbjct: 1210 GNKNVGVGVSNSGS 1223 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.0 bits (42), Expect = 9.6 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = -2 Query: 597 GDQTQPPEGYFRH 559 GDQ+QPP H Sbjct: 804 GDQSQPPHQQLHH 816 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,643 Number of Sequences: 438 Number of extensions: 3668 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18215697 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -