BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10d09 (654 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 25 0.41 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.2 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 23 2.2 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 23 2.9 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 23 2.9 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 23 2.9 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 23 2.9 AF260821-1|AAG02019.1| 134|Tribolium castaneum alpha-esterase l... 23 2.9 S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 22 3.8 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 22 3.8 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 21 6.7 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 25.4 bits (53), Expect = 0.41 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -1 Query: 534 FSCTIPYKSPPVMWDPTLTFNGLNSQSTSL 445 F I PP +P +TFN LN T L Sbjct: 167 FLAIIACMGPPPQPEPPVTFNSLNGAHTPL 196 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.0 bits (47), Expect = 2.2 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 205 IVTDTDQLVHSRSGHLFGSDDGSRY--GEDISE 113 I+T TDQ V +R+ F DD RY G ++S+ Sbjct: 13 ILTPTDQRVVTRTIPSFLRDDVERYPSGPELSD 45 Score = 21.8 bits (44), Expect = 5.1 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +2 Query: 413 IPKGINVPSLAREVDW 460 I G +VP LA+ +DW Sbjct: 1569 IDAGYDVPVLAQNLDW 1584 Score = 21.0 bits (42), Expect = 8.9 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = +2 Query: 413 IPKGINVPSLAREVDW 460 + G +VP+L++ +DW Sbjct: 1994 VDAGYDVPTLSKYLDW 2009 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 23.0 bits (47), Expect = 2.2 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Frame = -1 Query: 363 PSKMEPK-IPGPSSTDKGFPVR--STGSPT 283 P K P+ P PSST P + ST +PT Sbjct: 66 PWKKSPQGAPSPSSTPSSLPTQRTSTSNPT 95 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 22.6 bits (46), Expect = 2.9 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -2 Query: 335 DQVLLTKAFQYGVLDHLQLHLKFLRIPG 252 D VL+T ++ G+L L+ + L +PG Sbjct: 126 DVVLVTLNYRLGILGFLRFEDQSLGVPG 153 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 22.6 bits (46), Expect = 2.9 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -2 Query: 335 DQVLLTKAFQYGVLDHLQLHLKFLRIPG 252 D VL+T ++ G+L L+ + L +PG Sbjct: 128 DVVLVTLNYRLGILGFLRFEDQSLGVPG 155 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 22.6 bits (46), Expect = 2.9 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -2 Query: 335 DQVLLTKAFQYGVLDHLQLHLKFLRIPG 252 D VL+T ++ G+L L+ + L +PG Sbjct: 126 DVVLVTLNYRLGILGFLRFEDQSLGVPG 153 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 22.6 bits (46), Expect = 2.9 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -2 Query: 335 DQVLLTKAFQYGVLDHLQLHLKFLRIPG 252 D VL+T ++ G+L L+ + L +PG Sbjct: 128 DVVLVTLNYRLGILGFLRFEDQSLGVPG 155 >AF260821-1|AAG02019.1| 134|Tribolium castaneum alpha-esterase like protein E2 protein. Length = 134 Score = 22.6 bits (46), Expect = 2.9 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -2 Query: 335 DQVLLTKAFQYGVLDHLQLHLKFLRIPG 252 D VL+T ++ G+L L+ + L +PG Sbjct: 100 DVVLVTLNYRLGILGFLRFEDQSLGVPG 127 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 22.2 bits (45), Expect = 3.8 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -1 Query: 375 GR*IPSKMEPKIPGPSSTDKGFP 307 GR PS P+I PSST G P Sbjct: 63 GRKSPSS--PRISSPSSTKSGSP 83 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 22.2 bits (45), Expect = 3.8 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +3 Query: 555 CWSRPKPREQLPISHRP 605 C SRPK +E P H P Sbjct: 92 CTSRPKLQEPQPSQHCP 108 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 21.4 bits (43), Expect = 6.7 Identities = 10/24 (41%), Positives = 11/24 (45%) Frame = +3 Query: 546 STGCWSRPKPREQLPISHRPGTTK 617 S G S P E LP+ PG K Sbjct: 329 SDGATSEALPFELLPLDSEPGMLK 352 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,944 Number of Sequences: 336 Number of extensions: 3797 Number of successful extensions: 14 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -