BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10d09 (654 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g78900.1 68414.m09198 vacuolar ATP synthase catalytic subunit... 259 1e-69 At4g38510.2 68417.m05447 vacuolar ATP synthase subunit B, putati... 52 3e-07 At4g38510.1 68417.m05446 vacuolar ATP synthase subunit B, putati... 52 3e-07 At1g76030.1 68414.m08827 vacuolar ATP synthase subunit B / V-ATP... 50 1e-06 At1g20260.2 68414.m02530 vacuolar ATP synthase subunit B, putati... 50 1e-06 At1g20260.1 68414.m02529 vacuolar ATP synthase subunit B, putati... 50 1e-06 At5g08690.1 68418.m01034 ATP synthase beta chain 2, mitochondria... 40 0.002 At5g08680.1 68418.m01033 ATP synthase beta chain, mitochondrial,... 40 0.002 At5g08670.1 68418.m01032 ATP synthase beta chain 1, mitochondria... 40 0.002 At2g43870.1 68415.m05454 polygalacturonase, putative / pectinase... 31 0.67 At5g38340.1 68418.m04627 disease resistance protein (TIR-NBS-LRR... 30 1.5 At4g21240.1 68417.m03071 F-box family protein contains F-box dom... 29 2.7 At1g55390.1 68414.m06335 DC1 domain-containing protein similar t... 29 3.6 At5g62760.2 68418.m07879 nuclear protein ZAP-related similar to ... 28 4.7 At5g62760.1 68418.m07878 nuclear protein ZAP-related similar to ... 28 4.7 At5g57260.1 68418.m07152 cytochrome P450 71B10 identical to cyto... 28 4.7 At1g17970.1 68414.m02223 zinc finger (C3HC4-type RING finger) fa... 28 4.7 At4g12150.1 68417.m01930 zinc finger (C3HC4-type RING finger) fa... 28 6.2 At3g01040.1 68416.m00005 glycosyl transferase family 8 protein c... 27 8.2 At2g41820.1 68415.m05168 leucine-rich repeat transmembrane prote... 27 8.2 At1g34480.1 68414.m04285 DC1 domain-containing protein contains ... 27 8.2 >At1g78900.1 68414.m09198 vacuolar ATP synthase catalytic subunit A / V-ATPase A subunit / vacuolar proton pump alpha subunit / V-ATPase 69 kDa subunit identical to SP|O23654 Vacuolar ATP synthase catalytic subunit A (EC 3.6.3.14) (V-ATPase A subunit) (Vacuolar proton pump alpha subunit) (V-ATPase 69 kDa subunit) {Arabidopsis thaliana} Length = 623 Score = 259 bits (635), Expect = 1e-69 Identities = 121/194 (62%), Positives = 148/194 (76%) Frame = +2 Query: 71 GGLRTIANEENEERFGYVFAVSGPVVTAEKMSGSAMYELVRVGYNELVGEIIRLEGDMAT 250 G L T ++E E +GYV VSGPVV A+ M+G+AMYELVRVG++ L+GEIIRLEGD AT Sbjct: 7 GKLTTFEDDEKESEYGYVRKVSGPVVVADGMAGAAMYELVRVGHDNLIGEIIRLEGDSAT 66 Query: 251 IQVYEETSGVTVGDPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYIPKGIN 430 IQVYEET+G+TV DPVLRT KPLSVELGPGILG+IFDGIQRPLK I ++ +YIP+G++ Sbjct: 67 IQVYEETAGLTVNDPVLRTHKPLSVELGPGILGNIFDGIQRPLKTIARISGDVYIPRGVS 126 Query: 431 VPSLAREVDWEFNPLNVKVGSHITGGDLYGIVHENTLVKHRMLVPPKAKGTVTYIAPAGN 610 VP+L ++ WEF P G ITGGDLY V ENTL+ H + +PP A G +TYIAPAG Sbjct: 127 VPALDKDCLWEFQPNKFVEGDTITGGDLYATVFENTLMNHLVALPPDAMGKITYIAPAGQ 186 Query: 611 YKVTDVVLETEFDG 652 Y + D V+E EF G Sbjct: 187 YSLKDTVIELEFQG 200 >At4g38510.2 68417.m05447 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative very strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 487 Score = 52.0 bits (119), Expect = 3e-07 Identities = 30/102 (29%), Positives = 54/102 (52%), Gaps = 4/102 (3%) Frame = +2 Query: 122 VFAVSGPVVTAEKMSGSAMYELVRVGYNELV---GEIIRLEGDMATIQVYEETSGV-TVG 289 V V+GP+V EK+ G E+V + + G+++ ++G+ A +QV+E TSG+ Sbjct: 23 VSGVAGPLVILEKVKGPKYQEIVNIRLGDGTTRRGQVLEVDGEKAVVQVFEGTSGIDNKY 82 Query: 290 DPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYI 415 V TG+ L + +LG IF+G +P+ + + Y+ Sbjct: 83 TTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPEAYL 124 >At4g38510.1 68417.m05446 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative very strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 487 Score = 52.0 bits (119), Expect = 3e-07 Identities = 30/102 (29%), Positives = 54/102 (52%), Gaps = 4/102 (3%) Frame = +2 Query: 122 VFAVSGPVVTAEKMSGSAMYELVRVGYNELV---GEIIRLEGDMATIQVYEETSGV-TVG 289 V V+GP+V EK+ G E+V + + G+++ ++G+ A +QV+E TSG+ Sbjct: 23 VSGVAGPLVILEKVKGPKYQEIVNIRLGDGTTRRGQVLEVDGEKAVVQVFEGTSGIDNKY 82 Query: 290 DPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYI 415 V TG+ L + +LG IF+G +P+ + + Y+ Sbjct: 83 TTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPEAYL 124 >At1g76030.1 68414.m08827 vacuolar ATP synthase subunit B / V-ATPase B subunit / vacuolar proton pump B subunit / V-ATPase 57 kDa subunit identical to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana} Length = 486 Score = 50.4 bits (115), Expect = 1e-06 Identities = 29/102 (28%), Positives = 54/102 (52%), Gaps = 4/102 (3%) Frame = +2 Query: 122 VFAVSGPVVTAEKMSGSAMYELVRVGYNE---LVGEIIRLEGDMATIQVYEETSGV-TVG 289 V V+GP+V +K+ G E+V + + G+++ ++G+ A +QV+E TSG+ Sbjct: 22 VSGVAGPLVILDKVKGPKYQEIVNIRLGDGSTRRGQVLEVDGEKAVVQVFEGTSGIDNKF 81 Query: 290 DPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYI 415 V TG+ L + +LG IF+G +P+ + + Y+ Sbjct: 82 TTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPEAYL 123 >At1g20260.2 68414.m02530 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 485 Score = 50.4 bits (115), Expect = 1e-06 Identities = 29/102 (28%), Positives = 54/102 (52%), Gaps = 4/102 (3%) Frame = +2 Query: 122 VFAVSGPVVTAEKMSGSAMYELVRVGYNE---LVGEIIRLEGDMATIQVYEETSGV-TVG 289 V V+GP+V +K+ G E+V + + G+++ ++G+ A +QV+E TSG+ Sbjct: 22 VSGVAGPLVILDKVKGPKYQEIVNIRLGDGSTRRGQVLEVDGEKAVVQVFEGTSGIDNKF 81 Query: 290 DPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYI 415 V TG+ L + +LG IF+G +P+ + + Y+ Sbjct: 82 TTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPEAYL 123 >At1g20260.1 68414.m02529 vacuolar ATP synthase subunit B, putative / V-ATPase B subunit, putative / vacuolar proton pump B subunit, putative / V-ATPase 57 kDa subunit, putative strong similarity to SP|P11574 Vacuolar ATP synthase subunit B (EC 3.6.3.14) (V-ATPase B subunit) (Vacuolar proton pump B subunit) (V-ATPase 57 kDa subunit) {Arabidopsis thaliana}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 330 Score = 50.4 bits (115), Expect = 1e-06 Identities = 29/102 (28%), Positives = 54/102 (52%), Gaps = 4/102 (3%) Frame = +2 Query: 122 VFAVSGPVVTAEKMSGSAMYELVRVGYNE---LVGEIIRLEGDMATIQVYEETSGV-TVG 289 V V+GP+V +K+ G E+V + + G+++ ++G+ A +QV+E TSG+ Sbjct: 22 VSGVAGPLVILDKVKGPKYQEIVNIRLGDGSTRRGQVLEVDGEKAVVQVFEGTSGIDNKF 81 Query: 290 DPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYI 415 V TG+ L + +LG IF+G +P+ + + Y+ Sbjct: 82 TTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPEAYL 123 >At5g08690.1 68418.m01034 ATP synthase beta chain 2, mitochondrial identical to SP|P83484 ATP synthase beta chain 2, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}; strong similarity to SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain; supporting cDNA gi|26452187|dbj|AK118582.1| Length = 556 Score = 39.5 bits (88), Expect = 0.002 Identities = 19/58 (32%), Positives = 31/58 (53%) Frame = +2 Query: 269 TSGVTVGDPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYIPKGINVPSL 442 T G+ G VL TG P++V +G LG I + + P+ + E+ Y+P + P+L Sbjct: 141 TEGLVRGRKVLNTGAPITVPVGRATLGRIMNVLGEPIDERGEIKTEHYLPIHRDAPAL 198 >At5g08680.1 68418.m01033 ATP synthase beta chain, mitochondrial, putative strong similarity to SP|P83483 ATP synthase beta chain 1, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}, SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain Length = 559 Score = 39.5 bits (88), Expect = 0.002 Identities = 19/58 (32%), Positives = 31/58 (53%) Frame = +2 Query: 269 TSGVTVGDPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYIPKGINVPSL 442 T G+ G VL TG P++V +G LG I + + P+ + E+ Y+P + P+L Sbjct: 144 TEGLVRGRKVLNTGAPITVPVGRATLGRIMNVLGEPIDERGEIKTEHYLPIHRDAPAL 201 >At5g08670.1 68418.m01032 ATP synthase beta chain 1, mitochondrial identical to SP|P83483 ATP synthase beta chain 1, mitochondrial precursor (EC 3.6.3.14) {Arabidopsis thaliana}; strong similarity to SP|P17614 ATP synthase beta chain, mitochondrial precursor (EC 3.6.3.14) {Nicotiana plumbaginifolia}; contains Pfam profiles PF00006: ATP synthase alpha/beta family nucleotide-binding domain, PF00306: ATP synthase ab C terminal, PF02874: ATP synthase alpha/beta family beta-barrel domain; supporting cDNA gi|26452102|dbj|AK118538.1| Length = 556 Score = 39.5 bits (88), Expect = 0.002 Identities = 19/58 (32%), Positives = 31/58 (53%) Frame = +2 Query: 269 TSGVTVGDPVLRTGKPLSVELGPGILGSIFDGIQRPLKDINELTQSIYIPKGINVPSL 442 T G+ G VL TG P++V +G LG I + + P+ + E+ Y+P + P+L Sbjct: 141 TEGLVRGRKVLNTGAPITVPVGRATLGRIMNVLGEPIDERGEIKTEHYLPIHRDAPAL 198 >At2g43870.1 68415.m05454 polygalacturonase, putative / pectinase, putative similar to SP|P48979 Polygalacturonase precursor (EC 3.2.1.15) (PG) (Pectinase) {Prunus persica}; contains PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 384 Score = 31.1 bits (67), Expect = 0.67 Identities = 26/80 (32%), Positives = 38/80 (47%), Gaps = 4/80 (5%) Frame = -3 Query: 556 HPVLDQSVLVYNTIQISTGD----VGPDLNI*WVKFPVNLPGQGRHVDTLGDVDGLSQLV 389 H SV ++NT +ISTGD +GP N W++ PG G + +LG S + Sbjct: 194 HVQSSSSVSIFNT-KISTGDDCVSIGPGTNGLWIENVACGPGHGISIGSLGKDSVESGVQ 252 Query: 388 DVLEGTLNTVKDGTQDTGTK 329 +V T+ TV D G + Sbjct: 253 NV---TVKTVTFTGTDNGVR 269 >At5g38340.1 68418.m04627 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1059 Score = 29.9 bits (64), Expect = 1.5 Identities = 9/34 (26%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Frame = +2 Query: 377 LKDINELTQSIYIPKGIN-VPSLAREVDWEFNPL 475 L+ + + ++ +Y+P+G+N +P R ++W++ P+ Sbjct: 613 LRVLRDRSEKLYLPQGLNYLPKKLRLIEWDYFPM 646 >At4g21240.1 68417.m03071 F-box family protein contains F-box domain Pfam:PF00646 Length = 417 Score = 29.1 bits (62), Expect = 2.7 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +2 Query: 464 FNPLNVKVGSHITGGDLYGIVHENTLVKHRMLVP-PKAKGTVTY 592 +NP + V + GD Y IV N ++ + +P PK TV Y Sbjct: 125 YNPSSESVNGLVCFGDFYNIVVWNPSMRQHVTLPEPKPHSTVRY 168 >At1g55390.1 68414.m06335 DC1 domain-containing protein similar to hypothetical protein GI:4204272 from [Arabidopsis thaliana] contains weak PHD zinc finger motifs contains weak PHD zinc finger motifs DC1 domain, a divergent protein kinase C domain of unknown function. Length = 684 Score = 28.7 bits (61), Expect = 3.6 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = -3 Query: 253 DGGHVTFKTDNLTDEFIVTDTDQLVHSRSGHLFGSDDGSRYGED 122 DGGH + + D+ IV D D + R G G DG +D Sbjct: 124 DGGHDDEDNNFVDDDVIVNDGDGVGEDRDGDSDGDGDGGDDDDD 167 >At5g62760.2 68418.m07879 nuclear protein ZAP-related similar to nuclear protein ZAP, Mus musculus, EMBL:AB033168 this cDNA provides a truncated ORF likely due to a skipped exon. An alternative ORF is provided. Length = 383 Score = 28.3 bits (60), Expect = 4.7 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = -1 Query: 363 PSKMEPKIPGPSSTDKG-FPVRSTGSPTVTPEVSSYTWM 250 P + P P PSS FPV + SPT+ P SSY M Sbjct: 204 PLPVSPPPPLPSSHPSSLFPVTTNSSPTIPPS-SSYPQM 241 >At5g62760.1 68418.m07878 nuclear protein ZAP-related similar to nuclear protein ZAP, Mus musculus, EMBL:AB033168 this cDNA provides a truncated ORF likely due to a skipped exon. An alternative ORF is provided. Length = 661 Score = 28.3 bits (60), Expect = 4.7 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = -1 Query: 363 PSKMEPKIPGPSSTDKG-FPVRSTGSPTVTPEVSSYTWM 250 P + P P PSS FPV + SPT+ P SSY M Sbjct: 204 PLPVSPPPPLPSSHPSSLFPVTTNSSPTIPPS-SSYPQM 241 >At5g57260.1 68418.m07152 cytochrome P450 71B10 identical to cytochrome P450 71B10 (SP:Q9LVD2) [Arabidopsis thaliana] Length = 1483 Score = 28.3 bits (60), Expect = 4.7 Identities = 17/49 (34%), Positives = 22/49 (44%) Frame = -3 Query: 649 VELRLQHHVCDFVVPGRCDIGNCSLGFGRDQHPVLDQSVLVYNTIQIST 503 V + VC V+ G C IG L G + V D VLV N + +T Sbjct: 677 VNYPFDNFVCSAVISGFCKIGKPELALGFFESAV-DSGVLVPNLVTYTT 724 >At1g17970.1 68414.m02223 zinc finger (C3HC4-type RING finger) family protein similar to Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 368 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +2 Query: 401 QSIYIPKGINVPSLAREVDWEFNPLNVKVGSHI 499 +S+ P+G N+PS R++D + N N +GS + Sbjct: 163 RSVDPPRGRNIPSSRRKIDVDNNNYNHTLGSSV 195 >At4g12150.1 68417.m01930 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger) Length = 357 Score = 27.9 bits (59), Expect = 6.2 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = -3 Query: 625 VCDFVVPGRCDIGNCSLGFGRDQHPVLDQSVLVYNTIQISTGD 497 +CDF+ P + +LGFGR+ + + + Y T+ +++ D Sbjct: 265 LCDFLSP-KISTEFINLGFGRNGFTLTMDAKVTYRTVSVTSND 306 >At3g01040.1 68416.m00005 glycosyl transferase family 8 protein contains Pfam profile: PF01501 glycosyl transferase family 8 Length = 533 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/39 (35%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = +2 Query: 329 LGPGILGSIFDGIQRPLKDINELTQSI---YIPKGINVP 436 LGP +LG I D QR ++D ++ + IP G+ +P Sbjct: 77 LGPRLLGRIDDSEQRLVRDFYKILNEVSTQEIPDGLKLP 115 >At2g41820.1 68415.m05168 leucine-rich repeat transmembrane protein kinase, putative Length = 890 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +2 Query: 188 VRVGYNELVGEIIRLEGDMATIQVYEETSGVTVGDPVLRTGK 313 +R+G NELVG I R G+++ + +E G+ V K Sbjct: 259 IRIGNNELVGVIPRTIGNISGLTYFEADKNNLSGEIVAEFSK 300 >At1g34480.1 68414.m04285 DC1 domain-containing protein contains Pfam protein PF03107 DC1 domain Length = 602 Score = 27.5 bits (58), Expect = 8.2 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -3 Query: 628 HVCDFVVPGRCDIGNCSLGFGRDQH 554 H CDFVV C C + R QH Sbjct: 210 HQCDFVVHKECIYSPCIIKISRHQH 234 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,499,454 Number of Sequences: 28952 Number of extensions: 342792 Number of successful extensions: 1070 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 1029 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1059 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -