BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10d08 (308 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 23 0.64 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 23 1.1 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 22 1.5 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 22 1.9 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 21 4.5 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 20 7.8 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 20 7.8 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 20 7.8 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 20 7.8 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 23.4 bits (48), Expect = 0.64 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = +3 Query: 183 VCHPSLGVGQYQALPRQAIKLSQKNM 260 +C P L + A +QA+++S N+ Sbjct: 429 ICKPKLKIADLSAHDKQAVRMSALNV 454 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 22.6 bits (46), Expect = 1.1 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -1 Query: 161 ARKIISPLETLFLGGVQITLMFLCWATF 78 +R+I S + + + L F+CWA F Sbjct: 259 SRQIQSRKSVIKMLSAVVILFFICWAPF 286 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 22.2 bits (45), Expect = 1.5 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 156 PRRPDGGGLVCHPSLGVGQYQALPRQAIKLSQKN 257 PRR + L C P L GQ Q+ P+ + + N Sbjct: 341 PRRKNNCPLHCKPEL--GQSQSSPKFVARREESN 372 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.8 bits (44), Expect = 1.9 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -1 Query: 134 TLFLGGVQITLMFLCWATF 78 T L V IT F+CWA F Sbjct: 259 TRMLSAVVITF-FICWAPF 276 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 20.6 bits (41), Expect = 4.5 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 110 ITLMFLCWATFLKIWLLA 57 + F+CWA F LLA Sbjct: 291 VVAFFICWAPFHAQRLLA 308 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 19.8 bits (39), Expect = 7.8 Identities = 5/12 (41%), Positives = 10/12 (83%) Frame = +1 Query: 181 WSAIPAWVLVNI 216 W+A+PA V++ + Sbjct: 326 WNAVPARVMIGV 337 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 19.8 bits (39), Expect = 7.8 Identities = 5/12 (41%), Positives = 10/12 (83%) Frame = +1 Query: 181 WSAIPAWVLVNI 216 W+A+PA V++ + Sbjct: 295 WNAVPARVMIGV 306 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 19.8 bits (39), Expect = 7.8 Identities = 5/12 (41%), Positives = 10/12 (83%) Frame = +1 Query: 181 WSAIPAWVLVNI 216 W+A+PA V++ + Sbjct: 346 WNAVPARVMIGV 357 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 19.8 bits (39), Expect = 7.8 Identities = 5/12 (41%), Positives = 10/12 (83%) Frame = +1 Query: 181 WSAIPAWVLVNI 216 W+A+PA V++ + Sbjct: 295 WNAVPARVMIGV 306 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,154 Number of Sequences: 438 Number of extensions: 1801 Number of successful extensions: 11 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 6471036 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -