BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10d07 (360 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1783.01 |||FAD binding protein|Schizosaccharomyces pombe|chr... 26 2.0 SPBC16E9.18 ||SPBC1E8.01|phosphatidylserine decarboxylase|Schizo... 25 2.7 SPAC15E1.04 |||thymidylate synthase |Schizosaccharomyces pombe|c... 24 6.2 >SPAC1783.01 |||FAD binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 583 Score = 25.8 bits (54), Expect = 2.0 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +3 Query: 150 GNNGGKHCSFSPVVLREFNGRKHYIKVDCRRH 245 G++ C +V+ NGR+ Y++ RRH Sbjct: 485 GHHKNPKCRAKKLVVESRNGRREYVQDAVRRH 516 >SPBC16E9.18 ||SPBC1E8.01|phosphatidylserine decarboxylase|Schizosaccharomyces pombe|chr 2|||Manual Length = 437 Score = 25.4 bits (53), Expect = 2.7 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -1 Query: 123 HDWDQKPSHAKNGSAYDVNY*GSEK 49 HD ++PSH K+ SA ++ S K Sbjct: 229 HDHGERPSHVKDASAQHIDLLSSTK 253 >SPAC15E1.04 |||thymidylate synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 625 Score = 24.2 bits (50), Expect = 6.2 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -2 Query: 62 RAVKNPMILKSQ*LLT 15 RAVKNPMIL+ + LT Sbjct: 12 RAVKNPMILEKERQLT 27 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,596,853 Number of Sequences: 5004 Number of extensions: 31142 Number of successful extensions: 67 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 65 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 110009772 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -