BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10d06 (689 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 23 6.9 AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase p... 23 9.1 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 23.4 bits (48), Expect = 6.9 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -3 Query: 90 RASTATGRAGRSETVMRLAAP 28 RAS A A SE+VMR AAP Sbjct: 772 RASKAKLLASVSESVMRYAAP 792 >AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 23.0 bits (47), Expect = 9.1 Identities = 17/48 (35%), Positives = 21/48 (43%) Frame = +1 Query: 505 SGLVELTAAMSQNFATLLVMRFASGFLFNGPFAVLISYIAXLHRTELR 648 S L+EL S N TL M NGP +A +HRT+ R Sbjct: 94 SQLIELFLEQS-NPDTLTAMAVFVRDRVNGPLFQYALSVALMHRTDTR 140 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 543,643 Number of Sequences: 2352 Number of extensions: 9210 Number of successful extensions: 36 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69831885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -