BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10d06 (689 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 3.6 EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 21 8.4 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 21 8.4 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.6 bits (46), Expect = 3.6 Identities = 11/45 (24%), Positives = 20/45 (44%) Frame = +1 Query: 481 IMVWGFFCSGLVELTAAMSQNFATLLVMRFASGFLFNGPFAVLIS 615 +++ G LV + + RFA+GF F +A L++ Sbjct: 697 VLLSGILLCYLVTFALVLRPTDIVCGIQRFAAGFCFTVVYAALLT 741 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 21.4 bits (43), Expect = 8.4 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = -3 Query: 51 TVMRLAAPTRPSSG 10 T LAAP RPS G Sbjct: 9 TTATLAAPQRPSGG 22 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 21.4 bits (43), Expect = 8.4 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +2 Query: 455 CRTRSAGARSW 487 C+TR G RSW Sbjct: 345 CKTRIIGRRSW 355 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,146 Number of Sequences: 438 Number of extensions: 2712 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -