BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10d05 (659 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47652| Best HMM Match : Ribosomal_L10e (HMM E-Value=0.0041) 84 1e-16 SB_33920| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_45389| Best HMM Match : Peptidase_M13 (HMM E-Value=4.1e-09) 31 1.1 SB_7933| Best HMM Match : GCC2_GCC3 (HMM E-Value=1.4e-18) 30 1.5 SB_57196| Best HMM Match : ADAM_spacer1 (HMM E-Value=3.1e-31) 29 2.5 SB_28115| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_56325| Best HMM Match : Ribosomal_L14e (HMM E-Value=0.84) 29 3.4 SB_12964| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) 29 3.4 SB_5146| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_4321| Best HMM Match : Ank (HMM E-Value=0) 28 5.9 SB_29658| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0012) 28 5.9 SB_34832| Best HMM Match : SAP (HMM E-Value=1.4e-07) 28 7.7 SB_25165| Best HMM Match : Prominin (HMM E-Value=1.1e-05) 28 7.7 SB_810| Best HMM Match : TAF4 (HMM E-Value=4.7e-31) 28 7.7 >SB_47652| Best HMM Match : Ribosomal_L10e (HMM E-Value=0.0041) Length = 50 Score = 83.8 bits (198), Expect = 1e-16 Identities = 40/50 (80%), Positives = 43/50 (86%) Frame = +3 Query: 381 MRGAFGKPQGTVARVRIGQPIMSVRSSDRWKAQVIEALRRAKFKFPGRQK 530 MRGAFGKPQGTVARV IGQ I+S+R+ D KA IEALRRAKFKFPGRQK Sbjct: 1 MRGAFGKPQGTVARVNIGQTIISIRTKDGNKAAAIEALRRAKFKFPGRQK 50 >SB_33920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1278 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 2/54 (3%) Frame = -1 Query: 539 YVDLLTSGELELGTAQSLDDLCLPPVTRAHGHDGLSNANT--CYSTLRLAKRTT 384 Y + ++G + T D+C+P + HGH +ANT CY + A +T Sbjct: 68 YAESCSAGHYVVRTGNPFTDICIP--CQCHGHSDQCDANTGICYVRIYTADLST 119 >SB_45389| Best HMM Match : Peptidase_M13 (HMM E-Value=4.1e-09) Length = 177 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +3 Query: 231 LEAGRICCNKYLVKNCGKDQFHIRMRLHPFHVIRINKMLS 350 L I C Y KN +D +RM +HP H IRIN ++S Sbjct: 115 LSYAHIFCGSYS-KNAAEDI--VRMSVHPLHPIRINGVVS 151 >SB_7933| Best HMM Match : GCC2_GCC3 (HMM E-Value=1.4e-18) Length = 1023 Score = 30.3 bits (65), Expect = 1.5 Identities = 21/73 (28%), Positives = 26/73 (35%) Frame = -3 Query: 432 QCEHVLQYPEACQTHHASQSGAYQLQRMITFY*CG*RGKGEVSCGYGTDPFRSSLRGTYC 253 +C V Q P AC + S GA + Y C K V CG G T C Sbjct: 535 KCPDVTQAPVACTNGYYSGDGATECTLCPAGYSCADATKSPVPCGKGYYSTNGQTSCTEC 594 Query: 252 SRYVLPPKPLSSA 214 S P L ++ Sbjct: 595 SAGFYCPVELGTS 607 >SB_57196| Best HMM Match : ADAM_spacer1 (HMM E-Value=3.1e-31) Length = 718 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 43 GAGQRDATGTAKINRIRNRGSVGVYLIPRSVSSIWVRRERPLTTF 177 G G T N++ +G V LIP+ +I VR +P T+F Sbjct: 313 GNGTACYTVEGSFNQLAGKGYVEAALIPKGARNIRVREVKPCTSF 357 >SB_28115| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -3 Query: 234 PKPLSSAVHIRRTPSARTVESRQRSLSSYPNRRYGSWDQ 118 PK SS V+ RT AR ++R++ Y ++YG W Q Sbjct: 295 PKFFSSIVYYGRT--ARFDYGKRRNMKRYGKKKYGKWRQ 331 >SB_56325| Best HMM Match : Ribosomal_L14e (HMM E-Value=0.84) Length = 650 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -2 Query: 262 YLLQQIRPASKASELSCSYSSDTKCTHSGKSSTVALFLPKSKIR 131 Y+++QI+ ASK L + T C + K S V F+ K K R Sbjct: 252 YIVKQIQVASKVKVLKAKLENQTLCQQT-KRSKVTDFISKQKSR 294 >SB_12964| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) Length = 1273 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -2 Query: 262 YLLQQIRPASKASELSCSYSSDTKCTHSGKSSTVALFLPKSKIR 131 Y+++QI+ ASK L + T C + K S V F+ K K R Sbjct: 1020 YIVKQIQVASKVKVLKAKLENQTLCQQT-KRSKVTDFISKQKSR 1062 >SB_5146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2077 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/55 (21%), Positives = 26/55 (47%) Frame = +3 Query: 387 GAFGKPQGTVARVRIGQPIMSVRSSDRWKAQVIEALRRAKFKFPGRQKIYVSKKW 551 G G+P G+V + +++++ +W + E++ A + FP S+ W Sbjct: 1109 GVDGRPSGSVEILGSRDSFVAIQNGRQWMLDIEESISIAFYVFPNNSLGNTSRNW 1163 >SB_4321| Best HMM Match : Ank (HMM E-Value=0) Length = 915 Score = 28.3 bits (60), Expect = 5.9 Identities = 17/62 (27%), Positives = 26/62 (41%) Frame = +3 Query: 66 RYCKNKPYPKSRFCRGVPDPKIRIFDLGKKRATVDDFPLCVHLVSDEYEQLSSEALEAGR 245 R CK K ++R C+G + R+ K D+ +C SDE E + R Sbjct: 444 RMCKGKGRDETRMCKGEGTDETRMC----KSEGTDETRMCKDEGSDETRMCKDEGTDETR 499 Query: 246 IC 251 +C Sbjct: 500 MC 501 >SB_29658| Best HMM Match : zf-C3HC4 (HMM E-Value=0.0012) Length = 450 Score = 28.3 bits (60), Expect = 5.9 Identities = 25/88 (28%), Positives = 40/88 (45%), Gaps = 15/88 (17%) Frame = -3 Query: 321 GKGEVSCGYGTDPFRS-SLRGTYCSRYVLPPK----PLSSAVHIRRTPSARTVES----- 172 G + GY P+ + S R Y + LPP+ P SS + ++ P + E+ Sbjct: 359 GNYSATPGYERVPYANGSERNGYYNGTYLPPQGVITPRSSPLTVQEDPMNGSRENGLSNG 418 Query: 171 -----RQRSLSSYPNRRYGSWDQVHPDR 103 RQ SY +RRYG ++ +PD+ Sbjct: 419 HSDSRRQPMRLSYDSRRYGGYEAYYPDQ 446 >SB_34832| Best HMM Match : SAP (HMM E-Value=1.4e-07) Length = 1054 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/50 (26%), Positives = 25/50 (50%) Frame = +3 Query: 15 WCHFVKITMGRRPARCYRYCKNKPYPKSRFCRGVPDPKIRIFDLGKKRAT 164 W ++I++ R +R K+RF + VP+P+I+ G+ +T Sbjct: 137 WIDLLRISLNLRGNSVFRRSNKGEKEKARFKKSVPEPRIQPDSQGQVGST 186 >SB_25165| Best HMM Match : Prominin (HMM E-Value=1.1e-05) Length = 726 Score = 27.9 bits (59), Expect = 7.7 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +2 Query: 389 CVWQASGYCSTCSHWTAHHV 448 C W +G C C HW HV Sbjct: 79 CYWIRTGCCHLCWHWRPLHV 98 >SB_810| Best HMM Match : TAF4 (HMM E-Value=4.7e-31) Length = 883 Score = 27.9 bits (59), Expect = 7.7 Identities = 14/54 (25%), Positives = 25/54 (46%) Frame = +1 Query: 418 HVFALDSPSCPCALVTGGRHRSSRLCAVPSSSSPDVKRSTYQRSGVSQSMNVMS 579 HV A P P + + + +S A+ +SS+P + S Q + + + N S Sbjct: 261 HVIANQHPPAPVSQLQSNSNNASAARAITTSSNPSISTSVLQGNLSTNARNTAS 314 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,811,306 Number of Sequences: 59808 Number of extensions: 555757 Number of successful extensions: 1838 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1648 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1837 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1693527500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -