BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10c19 (647 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y17704-1|CAA76824.2| 401|Anopheles gambiae hypothetical protein... 25 1.6 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 25 2.1 DQ518576-1|ABF66618.1| 276|Anopheles gambiae putative cytoplasm... 24 4.8 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 6.3 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 6.3 >Y17704-1|CAA76824.2| 401|Anopheles gambiae hypothetical protein protein. Length = 401 Score = 25.4 bits (53), Expect = 1.6 Identities = 13/55 (23%), Positives = 27/55 (49%) Frame = +1 Query: 241 DGQVSKEEWISLWEKFSSSPSDWQNLYCKFIFQLEDASNDGSIDSEEFSSVYASF 405 DG+ + +++L+++ + S+ NL F+F+L +D E + Y F Sbjct: 52 DGEAILKPYLALYQQCRINASERANLRDNFLFRLNHWHDDHPFLLETVAKAYEPF 106 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 25.0 bits (52), Expect = 2.1 Identities = 13/40 (32%), Positives = 19/40 (47%), Gaps = 1/40 (2%) Frame = +1 Query: 67 TAFFDTNGSGTIDKKDFELAIERISKSRGWS-AGDAQYKE 183 T+ FD NG+ T D A I++ W+ GD Y + Sbjct: 161 TSTFDGNGAATASIVDVAFATPTIAQPGTWNVCGDYSYSD 200 >DQ518576-1|ABF66618.1| 276|Anopheles gambiae putative cytoplasmic carbonic anhydrase protein. Length = 276 Score = 23.8 bits (49), Expect = 4.8 Identities = 9/22 (40%), Positives = 12/22 (54%), Gaps = 1/22 (4%) Frame = +3 Query: 144 IERLEC-WRCSVQRSSRHAFEG 206 +E+ C W CS R S H +G Sbjct: 91 LEQFHCHWGCSDSRGSEHTVDG 112 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.4 bits (48), Expect = 6.3 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 202 KVWDGLSSADTDNDGQVSKEEWIS 273 KVW+ S D D DG+ E W++ Sbjct: 287 KVWNSASLIDVDRDGK--DELWLT 308 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.4 bits (48), Expect = 6.3 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 202 KVWDGLSSADTDNDGQVSKEEWIS 273 KVW+ S D D DG+ E W++ Sbjct: 287 KVWNSASLIDVDRDGK--DELWLT 308 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 676,391 Number of Sequences: 2352 Number of extensions: 14797 Number of successful extensions: 28 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -