BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10c18 (320 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45836| Best HMM Match : EGF (HMM E-Value=6.7e-21) 29 0.84 SB_55589| Best HMM Match : adh_short (HMM E-Value=0.14) 28 1.5 SB_13369| Best HMM Match : UPF0005 (HMM E-Value=0.3) 27 4.5 SB_28863| Best HMM Match : EzrA (HMM E-Value=1.1) 26 5.9 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.9 SB_41548| Best HMM Match : ResIII (HMM E-Value=0.27) 26 7.9 SB_47290| Best HMM Match : Ank (HMM E-Value=5.4e-29) 26 7.9 >SB_45836| Best HMM Match : EGF (HMM E-Value=6.7e-21) Length = 1332 Score = 29.1 bits (62), Expect = 0.84 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +2 Query: 113 RLWRSEHFSLLGGKKGRFPHRTELKARIGEDSSRT*CSGKIIL 241 +LW F + G KKG FP+ ++ R+ + + CS +IL Sbjct: 1080 QLWLLSRFKINGTKKGCFPYNKQIFWRLNKVKKKE-CSHTVIL 1121 >SB_55589| Best HMM Match : adh_short (HMM E-Value=0.14) Length = 337 Score = 28.3 bits (60), Expect = 1.5 Identities = 13/35 (37%), Positives = 22/35 (62%) Frame = -3 Query: 213 LLLSSPIRALSSVRWGNLPFLPPSKEKCSDRHNRH 109 L L+ + A+ V W +L FLPP++ + D HN++ Sbjct: 128 LQLAGAVIAVLFVAWLSLKFLPPTR-RVGDYHNKY 161 >SB_13369| Best HMM Match : UPF0005 (HMM E-Value=0.3) Length = 509 Score = 26.6 bits (56), Expect = 4.5 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Frame = -3 Query: 258 KYYFANKIIFPL---HYVLLLSSPIRALSSVRWGNLPFLPPSKEKCSDRHNRH 109 +Y ++FP+ H V+ +S P SS + PPS + R +RH Sbjct: 316 RYLHVTALVFPITIVHLVIFMSPPSSFQSSPSVSSSSLSPPSSFQSYHRPSRH 368 >SB_28863| Best HMM Match : EzrA (HMM E-Value=1.1) Length = 939 Score = 26.2 bits (55), Expect = 5.9 Identities = 16/50 (32%), Positives = 21/50 (42%) Frame = -3 Query: 273 QACTRKYYFANKIIFPLHYVLLLSSPIRALSSVRWGNLPFLPPSKEKCSD 124 Q C Y + +IFP Y L + LS R N + P +KC D Sbjct: 787 QKCLEAYLESKCVIFPRFYFLSNDELLEILSQTR--NPHAVQPHLQKCFD 834 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 25.8 bits (54), Expect = 7.9 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 4/37 (10%) Frame = -3 Query: 201 SPIRALSSVRWGNL----PFLPPSKEKCSDRHNRHRA 103 +PI ++ R GNL P L ++ C RH R+RA Sbjct: 325 APIAPRTTERLGNLWCEAPALQSDRKTCGVRHRRYRA 361 >SB_41548| Best HMM Match : ResIII (HMM E-Value=0.27) Length = 514 Score = 25.8 bits (54), Expect = 7.9 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -1 Query: 152 CHQVKRNVPTATTAIAPSAKALAADV 75 C V R+VP A A+ P+ KAL + Sbjct: 65 CMGVARHVPDAARALLPTVKALCVSM 90 >SB_47290| Best HMM Match : Ank (HMM E-Value=5.4e-29) Length = 445 Score = 25.8 bits (54), Expect = 7.9 Identities = 10/22 (45%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = -3 Query: 171 WGNLPFLPPSKEKC-SDRHNRH 109 WG+LPF + C S+RH H Sbjct: 213 WGDLPFCDQNNRSCGSNRHLNH 234 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,201,883 Number of Sequences: 59808 Number of extensions: 177916 Number of successful extensions: 354 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 344 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 354 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 425519554 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -