BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmmt10c13 (460 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_O77134 Cluster: CG3321-PA, isoform A; n=10; Endopterygo... 110 1e-23 UniRef50_Q4PM77 Cluster: ATP synthase E chain; n=2; Ixodidae|Rep... 69 5e-11 UniRef50_UPI0000588AA3 Cluster: PREDICTED: hypothetical protein;... 58 1e-07 UniRef50_P56385 Cluster: ATP synthase e chain, mitochondrial; n=... 49 4e-05 UniRef50_Q5BQW6 Cluster: SJCHGC09783 protein; n=1; Schistosoma j... 49 6e-05 UniRef50_P12633 Cluster: ATP synthase e chain, mitochondrial; n=... 47 2e-04 UniRef50_Q21732 Cluster: Putative uncharacterized protein; n=2; ... 45 7e-04 UniRef50_Q3SAY3 Cluster: Putative uncharacterized protein; n=2; ... 42 0.005 UniRef50_Q0TZ51 Cluster: Predicted protein; n=1; Phaeosphaeria n... 42 0.008 UniRef50_Q5KDU1 Cluster: Expressed protein; n=1; Filobasidiella ... 40 0.020 UniRef50_A6QZC0 Cluster: Predicted protein; n=4; Pezizomycotina|... 40 0.034 UniRef50_Q5CQL9 Cluster: Large low complexity coiled coil protie... 38 0.079 UniRef50_Q6BUT3 Cluster: Similar to CA1884|IPF5486 Candida albic... 38 0.10 UniRef50_A2FBI1 Cluster: Smooth muscle caldesmon, putative; n=5;... 37 0.24 UniRef50_Q54H52 Cluster: Putative uncharacterized protein; n=1; ... 36 0.32 UniRef50_A3MZ20 Cluster: Cell envelope integrity inner membrane ... 36 0.42 UniRef50_Q869H0 Cluster: Voltage-dependent T-type calcium channe... 36 0.42 UniRef50_Q0UJJ7 Cluster: Putative uncharacterized protein; n=1; ... 36 0.42 UniRef50_UPI000023DAB0 Cluster: hypothetical protein FG00429.1; ... 36 0.56 UniRef50_Q0IA64 Cluster: Putative uncharacterized protein; n=9; ... 36 0.56 UniRef50_Q556E8 Cluster: DNA ligase; n=2; Dictyostelium discoide... 36 0.56 UniRef50_Q18452 Cluster: Putative uncharacterized protein; n=2; ... 36 0.56 UniRef50_Q54J55 Cluster: Myb domain-containing protein; n=1; Dic... 35 0.73 UniRef50_A2FV34 Cluster: Trichohyalin, putative; n=2; Eukaryota|... 35 0.73 UniRef50_A7EPB7 Cluster: Putative uncharacterized protein; n=1; ... 35 0.73 UniRef50_UPI00015C4450 Cluster: lipoprotein, putative; n=1; Stre... 35 0.97 UniRef50_Q23JX3 Cluster: Putative uncharacterized protein; n=1; ... 34 1.3 UniRef50_A4R849 Cluster: Predicted protein; n=1; Magnaporthe gri... 34 1.3 UniRef50_A3GH16 Cluster: Predicted protein; n=2; Pichia stipitis... 34 1.3 UniRef50_Q95L36 Cluster: Smooth muscle caldesmon protein; n=1; O... 34 1.7 UniRef50_UPI000023ECEF Cluster: hypothetical protein FG05106.1; ... 33 2.2 UniRef50_A2E7B0 Cluster: Putative uncharacterized protein; n=5; ... 33 2.2 UniRef50_A6SBI4 Cluster: Putative uncharacterized protein; n=1; ... 33 2.2 UniRef50_P29720 Cluster: Treponemal membrane protein B precursor... 33 2.2 UniRef50_P05661 Cluster: Myosin heavy chain, muscle; n=90; Bilat... 33 2.2 UniRef50_O04096 Cluster: F-box protein At1g10890; n=8; core eudi... 33 2.2 UniRef50_Q4S3B9 Cluster: Chromosome 1 SCAF14751, whole genome sh... 33 3.0 UniRef50_Q4RQT6 Cluster: Chromosome 2 SCAF15004, whole genome sh... 33 3.0 UniRef50_Q5CHL0 Cluster: Garp protein; n=3; Cryptosporidium|Rep:... 33 3.0 UniRef50_Q23DV1 Cluster: Putative uncharacterized protein; n=1; ... 33 3.0 UniRef50_Q6FNW3 Cluster: Candida glabrata strain CBS138 chromoso... 33 3.0 UniRef50_Q6CGN4 Cluster: Similarity; n=4; Eukaryota|Rep: Similar... 33 3.0 UniRef50_A4RP63 Cluster: Putative uncharacterized protein; n=1; ... 33 3.0 UniRef50_Q8ILS1 Cluster: Putative uncharacterized protein; n=1; ... 33 3.9 UniRef50_Q5C690 Cluster: SJCHGC04883 protein; n=1; Schistosoma j... 33 3.9 UniRef50_A2EUZ9 Cluster: Kelch motif family protein; n=1; Tricho... 33 3.9 UniRef50_Q7S2K6 Cluster: Predicted protein; n=3; Sordariomycetes... 33 3.9 UniRef50_Q2HAW1 Cluster: Putative uncharacterized protein; n=1; ... 33 3.9 UniRef50_Q2GSB9 Cluster: Putative uncharacterized protein; n=1; ... 33 3.9 UniRef50_A2R8W1 Cluster: Contig An16c0270, complete genome; n=2;... 33 3.9 UniRef50_UPI0000DB7211 Cluster: PREDICTED: similar to Stretchin-... 32 5.2 UniRef50_Q5R1T0 Cluster: Chromatin assembly factor-1p150; n=6; A... 32 5.2 UniRef50_A5I4E1 Cluster: Hypothetical phage protein; n=1; Clostr... 32 5.2 UniRef50_A3VQ48 Cluster: Sensor protein; n=1; Parvularcula bermu... 32 5.2 UniRef50_Q9MAA8 Cluster: T12H1.7 protein; n=1; Arabidopsis thali... 32 5.2 UniRef50_Q7XT54 Cluster: OSJNBa0010D21.8 protein; n=5; Oryza sat... 32 5.2 UniRef50_Q2TA33 Cluster: LOC616002 protein; n=3; Bos taurus|Rep:... 32 5.2 UniRef50_A5E1H8 Cluster: Putative uncharacterized protein; n=1; ... 32 5.2 UniRef50_UPI000155C1F8 Cluster: PREDICTED: hypothetical protein;... 32 6.8 UniRef50_UPI000023D4D6 Cluster: hypothetical protein FG11138.1; ... 32 6.8 UniRef50_Q4S8N4 Cluster: Chromosome 7 SCAF14703, whole genome sh... 32 6.8 UniRef50_Q1DBV7 Cluster: TldD/PmbA family protein; n=1; Myxococc... 32 6.8 UniRef50_A6QAG2 Cluster: Oxidoreductase; n=2; Sulfurovum sp. NBC... 32 6.8 UniRef50_A5FBV3 Cluster: Mammalian cell entry related domain pro... 32 6.8 UniRef50_A3NLV7 Cluster: Putative uncharacterized protein; n=1; ... 32 6.8 UniRef50_A0L961 Cluster: Sel1 domain protein repeat-containing p... 32 6.8 UniRef50_Q9VYU0 Cluster: CG32662-PA; n=2; Drosophila melanogaste... 32 6.8 UniRef50_Q54UA6 Cluster: Putative uncharacterized protein; n=1; ... 32 6.8 UniRef50_Q4UGF8 Cluster: Dead/deah box RNA helicase, putative; n... 32 6.8 UniRef50_O44991 Cluster: Lipid depleted protein 6; n=5; Bilateri... 32 6.8 UniRef50_Q6C373 Cluster: Similarity; n=1; Yarrowia lipolytica|Re... 32 6.8 UniRef50_Q12263 Cluster: Serine/threonine-protein kinase GIN4; n... 32 6.8 UniRef50_UPI0000E46A9B Cluster: PREDICTED: similar to MGC68765 p... 31 9.0 UniRef50_UPI0000DB6B60 Cluster: PREDICTED: hypothetical protein;... 31 9.0 UniRef50_UPI00006CD0F6 Cluster: Protein kinase domain containing... 31 9.0 UniRef50_Q4RZS5 Cluster: Chromosome 18 SCAF14786, whole genome s... 31 9.0 UniRef50_Q2B5K8 Cluster: Putative uncharacterized protein; n=1; ... 31 9.0 UniRef50_Q04UH0 Cluster: Endoflagellar hook-length control prote... 31 9.0 UniRef50_A4EEC0 Cluster: Putative uncharacterized protein; n=1; ... 31 9.0 UniRef50_A2XRS1 Cluster: Putative uncharacterized protein; n=1; ... 31 9.0 UniRef50_Q5CRM2 Cluster: Putative uncharacterized protein; n=1; ... 31 9.0 UniRef50_Q227C1 Cluster: Putative uncharacterized protein; n=2; ... 31 9.0 UniRef50_A7T0N7 Cluster: Predicted protein; n=1; Nematostella ve... 31 9.0 UniRef50_Q5KHY3 Cluster: Putative uncharacterized protein; n=1; ... 31 9.0 UniRef50_Q4PGQ7 Cluster: Putative uncharacterized protein; n=1; ... 31 9.0 UniRef50_Q1MTN9 Cluster: Chromatin remodeling complex subunit Rl... 31 9.0 UniRef50_A4RJF9 Cluster: Putative uncharacterized protein; n=1; ... 31 9.0 UniRef50_A3LYI0 Cluster: Negative affector of Salt Tolerance; n=... 31 9.0 >UniRef50_O77134 Cluster: CG3321-PA, isoform A; n=10; Endopterygota|Rep: CG3321-PA, isoform A - Drosophila melanogaster (Fruit fly) Length = 81 Score = 110 bits (265), Expect = 1e-23 Identities = 51/77 (66%), Positives = 63/77 (81%) Frame = +1 Query: 103 APVRISPLIKFGRWSFLTVGVLYGAFHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERA 282 APVR+SPLIKFGRWS L VG+ YGA HQ+RLSKKE KLREIEA++K +RDAKL EEK+R+ Sbjct: 4 APVRVSPLIKFGRWSLLLVGIAYGAAHQSRLSKKEEKLREIEAQQKAVRDAKLAEEKKRS 63 Query: 283 SALEIKALEEMASGTAK 333 + E +AL E++ T K Sbjct: 64 AEAEARALAELSKPTPK 80 >UniRef50_Q4PM77 Cluster: ATP synthase E chain; n=2; Ixodidae|Rep: ATP synthase E chain - Ixodes scapularis (Black-legged tick) (Deer tick) Length = 85 Score = 68.9 bits (161), Expect = 5e-11 Identities = 33/67 (49%), Positives = 44/67 (65%) Frame = +1 Query: 106 PVRISPLIKFGRWSFLTVGVLYGAFHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERAS 285 PV +SP I+ RW LT GV YGA+H RLS+KE KLRE EA++ + K +EEK + + Sbjct: 7 PVAVSPFIRACRWGALTAGVFYGAYHFRRLSRKETKLREYEAQQMELMREKREEEKRKKN 66 Query: 286 ALEIKAL 306 E+ AL Sbjct: 67 REEMIAL 73 >UniRef50_UPI0000588AA3 Cluster: PREDICTED: hypothetical protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 73 Score = 57.6 bits (133), Expect = 1e-07 Identities = 27/62 (43%), Positives = 41/62 (66%) Frame = +1 Query: 103 APVRISPLIKFGRWSFLTVGVLYGAFHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERA 282 AP+ +SPLI+F R+S L VG+ YG+ H L KKEA + +++AK K D K+++ A Sbjct: 4 APLAVSPLIRFARYSALFVGIAYGSRHNKTLEKKEAYILDMKAKAKEAEDKKVEQAAVVA 63 Query: 283 SA 288 +A Sbjct: 64 AA 65 >UniRef50_P56385 Cluster: ATP synthase e chain, mitochondrial; n=20; Euteleostomi|Rep: ATP synthase e chain, mitochondrial - Homo sapiens (Human) Length = 69 Score = 49.2 bits (112), Expect = 4e-05 Identities = 26/59 (44%), Positives = 36/59 (61%) Frame = +1 Query: 106 PVRISPLIKFGRWSFLTVGVLYGAFHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERA 282 PV++SPLIK GR+S L +GV YGA N L + + R I A+EK +D + +E A Sbjct: 4 PVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELA 62 >UniRef50_Q5BQW6 Cluster: SJCHGC09783 protein; n=1; Schistosoma japonicum|Rep: SJCHGC09783 protein - Schistosoma japonicum (Blood fluke) Length = 85 Score = 48.8 bits (111), Expect = 6e-05 Identities = 24/70 (34%), Positives = 40/70 (57%) Frame = +1 Query: 103 APVRISPLIKFGRWSFLTVGVLYGAFHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERA 282 AP +SPLI+ RW L G++YGA + L+K+E K+ E ++ + + +L E E Sbjct: 8 APREVSPLIRTARWGLLVAGIVYGALRLSYLTKREKKISE---HDRAVIEKRLTEYNEWV 64 Query: 283 SALEIKALEE 312 + + K+L E Sbjct: 65 ALQKEKSLRE 74 >UniRef50_P12633 Cluster: ATP synthase e chain, mitochondrial; n=6; Mammalia|Rep: ATP synthase e chain, mitochondrial - Cricetulus longicaudatus (Long-tailed hamster) (Chinese hamster) Length = 69 Score = 47.2 bits (107), Expect = 2e-04 Identities = 24/59 (40%), Positives = 36/59 (61%) Frame = +1 Query: 106 PVRISPLIKFGRWSFLTVGVLYGAFHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERA 282 PV++SPLIK GR+S L +G+ YGA + L + + R + A+EK D + E+E A Sbjct: 4 PVQVSPLIKLGRYSALVLGMAYGAKRYSYLKPRAEEERRVAAEEKKRLDELKRIERELA 62 >UniRef50_Q21732 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 107 Score = 45.2 bits (102), Expect = 7e-04 Identities = 22/71 (30%), Positives = 45/71 (63%) Frame = +1 Query: 109 VRISPLIKFGRWSFLTVGVLYGAFHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASA 288 V ISPLI+FGR++ L++GV+YG F ++ + A +RE + ++ V + ++K+ + Sbjct: 18 VTISPLIRFGRYAALSLGVVYGFFRLRQIREYHADIREWDHEKAVAAAEEAAKKKKWLAK 77 Query: 289 LEIKALEEMAS 321 E++ L ++ + Sbjct: 78 DEMRYLMQVVN 88 >UniRef50_Q3SAY3 Cluster: Putative uncharacterized protein; n=2; Amniota|Rep: Putative uncharacterized protein - Oxyuranus scutellatus Length = 50 Score = 42.3 bits (95), Expect = 0.005 Identities = 21/45 (46%), Positives = 29/45 (64%) Frame = +1 Query: 106 PVRISPLIKFGRWSFLTVGVLYGAFHQNRLSKKEAKLREIEAKEK 240 PV +SPLIK R+S L +G++YGA L A+ R +EA+EK Sbjct: 4 PVEVSPLIKLCRYSALLLGIIYGARRYAYLKPIAAEDRRLEAEEK 48 >UniRef50_Q0TZ51 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 87 Score = 41.5 bits (93), Expect = 0.008 Identities = 23/43 (53%), Positives = 26/43 (60%), Gaps = 3/43 (6%) Frame = +1 Query: 139 RWSFLTVGVLYGAFHQNRLS---KKEAKLREIEAKEKVIRDAK 258 RWS L GV YGA+HQ LS K A +E E KE +IR AK Sbjct: 11 RWSALGFGVFYGAYHQLSLSARDKANASKKEWEHKESLIRQAK 53 >UniRef50_Q5KDU1 Cluster: Expressed protein; n=1; Filobasidiella neoformans|Rep: Expressed protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 90 Score = 40.3 bits (90), Expect = 0.020 Identities = 22/57 (38%), Positives = 30/57 (52%) Frame = +1 Query: 118 SPLIKFGRWSFLTVGVLYGAFHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASA 288 +P + RWS L G+ YG FHQ+ L +AK E + K A L EE ++A A Sbjct: 3 TPTVNVVRWSALIAGITYGIFHQSTL---QAKYDEDKVKHHAAHRAHLVEEAKKAYA 56 >UniRef50_A6QZC0 Cluster: Predicted protein; n=4; Pezizomycotina|Rep: Predicted protein - Ajellomyces capsulatus NAm1 Length = 96 Score = 39.5 bits (88), Expect = 0.034 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 3/57 (5%) Frame = +1 Query: 139 RWSFLTVGVLYGAFHQNRLSK--KEAKL-REIEAKEKVIRDAKLKEEKERASALEIK 300 R+S L G++YG FHQ+ L+ K+A++ RE KE +I A+ + K+ A A E+K Sbjct: 11 RYSALGAGIVYGLFHQSSLTSQAKQAQIDREYSRKESLIEQARAEYAKKNAPA-EVK 66 >UniRef50_Q5CQL9 Cluster: Large low complexity coiled coil protien with large repeat region; n=4; cellular organisms|Rep: Large low complexity coiled coil protien with large repeat region - Cryptosporidium parvum Iowa II Length = 1833 Score = 38.3 bits (85), Expect = 0.079 Identities = 26/54 (48%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 SKKEAKLREIEA---KEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 +KKE + E EA KEK +AK K+EKE A A +K EE A AKK K+K Sbjct: 695 AKKEKEKEEAEAKAKKEKEEAEAKAKKEKEEAEAKALKEKEE-AEAKAKKEKEK 747 Score = 36.3 bits (80), Expect = 0.32 Identities = 22/50 (44%), Positives = 32/50 (64%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 K+EA+ + ++ KE+ +AK K+EKE A A +K EE A AKK K+K Sbjct: 655 KEEAEAKALKEKEEA--EAKAKKEKEEAEAKALKEKEE-AEAKAKKEKEK 701 Score = 35.1 bits (77), Expect = 0.73 Identities = 22/50 (44%), Positives = 30/50 (60%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 K+EA+ + + KEK +AK K+EKE A A K EE A AKK K++ Sbjct: 734 KEEAEAKAKKEKEKEEAEAKAKKEKEEAEAKAKKEKEE-AEAKAKKEKEE 782 Score = 34.7 bits (76), Expect = 0.97 Identities = 25/54 (46%), Positives = 31/54 (57%), Gaps = 3/54 (5%) Frame = +1 Query: 196 SKKEAKLREIEA---KEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 +KKE + E EA KEK +AK K+EKE A A K EE A AKK K++ Sbjct: 741 AKKEKEKEEAEAKAKKEKEEAEAKAKKEKEEAEAKAKKEKEE-AEAKAKKEKEE 793 Score = 34.7 bits (76), Expect = 0.97 Identities = 24/53 (45%), Positives = 31/53 (58%), Gaps = 2/53 (3%) Frame = +1 Query: 196 SKKEAKLREIEAK-EKVIRDAKLKEEKERASA-LEIKALEEMASGTAKK*KDK 348 +KKE + E +AK EK +AK K+EKE A A E KA +E AK K+K Sbjct: 809 AKKEKEEAEAKAKKEKEEAEAKAKKEKEEAEAEAEAKAKKEKEEAEAKAKKEK 861 Score = 33.9 bits (74), Expect = 1.7 Identities = 23/52 (44%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +1 Query: 196 SKKEAKLREIEA-KEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 +KKE + E +A KEK +AK K+EKE+ A E KA +E AK K+K Sbjct: 673 AKKEKEEAEAKALKEKEEAEAKAKKEKEKEEA-EAKAKKEKEEAEAKAKKEK 723 Score = 33.9 bits (74), Expect = 1.7 Identities = 23/52 (44%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +1 Query: 196 SKKEAKLREIEA-KEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 +KKE + E +A KEK +AK K+EKE+ A E KA +E AK K+K Sbjct: 719 AKKEKEEAEAKALKEKEEAEAKAKKEKEKEEA-EAKAKKEKEEAEAKAKKEK 769 Score = 33.9 bits (74), Expect = 1.7 Identities = 24/52 (46%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +1 Query: 196 SKKEAKLREIEAK-EKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 +KKE + E +AK EK +AK K+EKE A A K EE A AKK K++ Sbjct: 754 AKKEKEEAEAKAKKEKEEAEAKAKKEKEEAEAKAKKEKEE-AEAKAKKEKEE 804 Score = 33.9 bits (74), Expect = 1.7 Identities = 24/52 (46%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +1 Query: 196 SKKEAKLREIEAK-EKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 +KKE + E +AK EK +AK K+EKE A A K EE A AKK K++ Sbjct: 765 AKKEKEEAEAKAKKEKEEAEAKAKKEKEEAEAKAKKEKEE-AEAKAKKEKEE 815 Score = 33.9 bits (74), Expect = 1.7 Identities = 24/52 (46%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +1 Query: 196 SKKEAKLREIEAK-EKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 +KKE + E +AK EK +AK K+EKE A A K EE A AKK K++ Sbjct: 776 AKKEKEEAEAKAKKEKEEAEAKAKKEKEEAEAKAKKEKEE-AEAKAKKEKEE 826 Score = 33.9 bits (74), Expect = 1.7 Identities = 24/52 (46%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +1 Query: 196 SKKEAKLREIEAK-EKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 +KKE + E +AK EK +AK K+EKE A A K EE A AKK K++ Sbjct: 787 AKKEKEEAEAKAKKEKEEAEAKAKKEKEEAEAKAKKEKEE-AEAKAKKEKEE 837 Score = 33.9 bits (74), Expect = 1.7 Identities = 24/52 (46%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +1 Query: 196 SKKEAKLREIEAK-EKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 +KKE + E +AK EK +AK K+EKE A A K EE A AKK K++ Sbjct: 846 AKKEKEEAEAKAKKEKEEAEAKAKKEKEEAEAKAKKEKEE-AEAKAKKEKEE 896 Score = 33.9 bits (74), Expect = 1.7 Identities = 24/52 (46%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +1 Query: 196 SKKEAKLREIEAK-EKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 +KKE + E +AK EK +AK K+EKE A A K EE A AKK K++ Sbjct: 857 AKKEKEEAEAKAKKEKEEAEAKAKKEKEEAEAKAKKEKEE-AEAKAKKEKEE 907 Score = 33.9 bits (74), Expect = 1.7 Identities = 24/52 (46%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +1 Query: 196 SKKEAKLREIEAK-EKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 +KKE + E +AK EK +AK K+EKE A A K EE A AKK K++ Sbjct: 868 AKKEKEEAEAKAKKEKEEAEAKAKKEKEEAEAKAKKEKEE-AEAKAKKEKEE 918 Score = 33.9 bits (74), Expect = 1.7 Identities = 24/52 (46%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +1 Query: 196 SKKEAKLREIEAK-EKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 +KKE + E +AK EK +AK K+EKE A A K EE A AKK K++ Sbjct: 879 AKKEKEEAEAKAKKEKEEAEAKAKKEKEEAEAKAKKEKEE-AEAKAKKEKEE 929 Score = 33.1 bits (72), Expect = 3.0 Identities = 21/50 (42%), Positives = 29/50 (58%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 K+EA+ + + KEK +AK K+EKE A E KA +E AK K+K Sbjct: 688 KEEAEAKAKKEKEKEEAEAKAKKEKEEA---EAKAKKEKEEAEAKALKEK 734 Score = 32.7 bits (71), Expect = 3.9 Identities = 24/53 (45%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = +1 Query: 196 SKKEAKLREIEAK-EKVIRDAKLKEEKERASALEIKALEEM-ASGTAKK*KDK 348 +KKE + E +AK EK +AK K+EKE A A K EE A AK K+K Sbjct: 798 AKKEKEEAEAKAKKEKEEAEAKAKKEKEEAEAKAKKEKEEAEAEAEAKAKKEK 850 Score = 32.3 bits (70), Expect = 5.2 Identities = 25/56 (44%), Positives = 31/56 (55%), Gaps = 5/56 (8%) Frame = +1 Query: 196 SKKEAKLREIEA-----KEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 +KKE + E EA KEK +AK K+EKE A A K EE A AKK K++ Sbjct: 831 AKKEKEEAEAEAEAKAKKEKEEAEAKAKKEKEEAEAKAKKEKEE-AEAKAKKEKEE 885 >UniRef50_Q6BUT3 Cluster: Similar to CA1884|IPF5486 Candida albicans; n=1; Debaryomyces hansenii|Rep: Similar to CA1884|IPF5486 Candida albicans - Debaryomyces hansenii (Yeast) (Torulaspora hansenii) Length = 1179 Score = 37.9 bits (84), Expect = 0.10 Identities = 23/57 (40%), Positives = 35/57 (61%), Gaps = 5/57 (8%) Frame = +1 Query: 181 HQNRLS---KKEAKLREI--EAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK 336 HQ RL KKE + +++ E K+K+ + K KEE++R L+ K +EE S +AKK Sbjct: 749 HQKRLEAQRKKEEETKKLKDEKKKKIEEERKQKEEEKRQKELQKKLVEEERSKSAKK 805 >UniRef50_A2FBI1 Cluster: Smooth muscle caldesmon, putative; n=5; Eukaryota|Rep: Smooth muscle caldesmon, putative - Trichomonas vaginalis G3 Length = 1054 Score = 36.7 bits (81), Expect = 0.24 Identities = 20/55 (36%), Positives = 31/55 (56%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 + + K+E + +E EAKEK ++ K KEE+ER E K EE +K K++ Sbjct: 541 KEKREKEERERKEKEAKEKAEKERKEKEERERKEREERKEKEERKEREERKEKEE 595 Score = 36.7 bits (81), Expect = 0.24 Identities = 20/55 (36%), Positives = 31/55 (56%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 + + K+E + +E EAKEK ++ K KEE+ER E K EE +K K++ Sbjct: 637 KEKREKEERERKEKEAKEKAEKERKEKEERERKEREERKEKEERKEKEERKEKEE 691 Score = 35.1 bits (77), Expect = 0.73 Identities = 17/32 (53%), Positives = 22/32 (68%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKER 279 + R K+E + RE EAKEK R+ K +EEKER Sbjct: 684 EERKEKEEKEKREREAKEKAERERKEREEKER 715 Score = 34.3 bits (75), Expect = 1.3 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEE 312 + R K+E + RE EAKEK R+ K +EE+ER E + E+ Sbjct: 600 EERKEKEEKEKREREAKEKAERERKEREERERKEKEEKEKREK 642 Score = 32.7 bits (71), Expect = 3.9 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKER 279 + R ++E + +E EAKEK R+ K +EEKER Sbjct: 420 EERKEREERERKEKEAKEKAERERKEREEKER 451 Score = 32.7 bits (71), Expect = 3.9 Identities = 17/43 (39%), Positives = 26/43 (60%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEE 312 + R K+E + RE EAKEK ++ K +EE+ER E + E+ Sbjct: 504 KERKEKEEREKREREAKEKAEKERKEREERERKEKEEKEKREK 546 Score = 31.5 bits (68), Expect = 9.0 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEE 312 + + ++E + +E EAKEK R+ K +EEKER E K EE Sbjct: 331 REKKEREERERKEREAKEKAERERKEREEKERKER-ERKEKEE 372 >UniRef50_Q54H52 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 1704 Score = 36.3 bits (80), Expect = 0.32 Identities = 22/47 (46%), Positives = 30/47 (63%), Gaps = 1/47 (2%) Frame = +1 Query: 199 KKEAKLR-EIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK 336 +KEAK + E EAKEK+ R+AK K EKE LE +A E++ +K Sbjct: 1210 EKEAKEKLEREAKEKLEREAKEKAEKEAKEKLEKEAKEKLEKEAKEK 1256 Score = 31.9 bits (69), Expect = 6.8 Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = +1 Query: 199 KKEAKLR-EIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTA 330 ++EAK + E EAKEK ++AK K EKE LE +A E+ +A Sbjct: 1218 EREAKEKLEREAKEKAEKEAKEKLEKEAKEKLEKEAKEKAEKDSA 1262 Score = 31.5 bits (68), Expect = 9.0 Identities = 19/48 (39%), Positives = 30/48 (62%), Gaps = 1/48 (2%) Frame = +1 Query: 196 SKKEAKLR-EIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK 336 ++KEA+ + E EAKEK+ R+AK K E+E E +A E++ +K Sbjct: 1201 AEKEAREKIEKEAKEKLEREAKEKLEREAKEKAEKEAKEKLEKEAKEK 1248 >UniRef50_A3MZ20 Cluster: Cell envelope integrity inner membrane protein TolA; n=4; Pasteurellaceae|Rep: Cell envelope integrity inner membrane protein TolA - Actinobacillus pleuropneumoniae serotype 5b (strain L20) Length = 431 Score = 35.9 bits (79), Expect = 0.42 Identities = 21/48 (43%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Frame = +1 Query: 196 SKKEAKLR-EIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK 336 ++KEAKL+ E EAKEK ++AKLK EK+ + E +A + A+ K Sbjct: 239 AEKEAKLKAEKEAKEKAEKEAKLKAEKDAKAKAEKEAKAKAAAEAKAK 286 Score = 34.3 bits (75), Expect = 1.3 Identities = 19/41 (46%), Positives = 27/41 (65%), Gaps = 1/41 (2%) Frame = +1 Query: 184 QNRLSKKEAKLR-EIEAKEKVIRDAKLKEEKERASALEIKA 303 + + ++KEAKL+ E EAKEK ++AK K EKE E +A Sbjct: 203 EQKQAEKEAKLKAEKEAKEKAEKEAKAKAEKEAKEKAEKEA 243 Score = 33.5 bits (73), Expect = 2.2 Identities = 19/37 (51%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = +1 Query: 196 SKKEAKLR-EIEAKEKVIRDAKLKEEKERASALEIKA 303 ++KEAK + E EAKEK ++AKLK EKE E +A Sbjct: 223 AEKEAKAKAEKEAKEKAEKEAKLKAEKEAKEKAEKEA 259 Score = 31.5 bits (68), Expect = 9.0 Identities = 23/54 (42%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = +1 Query: 196 SKKEAKLR-EIEAKEKVIRDAKLKEEKE--RASALEIKALEEMASGTAKK*KDK 348 ++KEAK + E EAK K +DAK K EKE +A E KA + A+ A+ +K Sbjct: 247 AEKEAKEKAEKEAKLKAEKDAKAKAEKEAKAKAAAEAKAKADAAAKAAQAKNNK 300 >UniRef50_Q869H0 Cluster: Voltage-dependent T-type calcium channel alpha-1 subunit; n=1; Lymnaea stagnalis|Rep: Voltage-dependent T-type calcium channel alpha-1 subunit - Lymnaea stagnalis (Great pond snail) Length = 1942 Score = 35.9 bits (79), Expect = 0.42 Identities = 30/103 (29%), Positives = 48/103 (46%), Gaps = 2/103 (1%) Frame = +1 Query: 19 IGFFQKVSYNNCFTVQQFYNKMSDLPYGAPVRISPLIKFGRWSF--LTVGVLYGAFHQNR 192 I FQ ++ + TV YN M+ A + L+ FG + L V +L F Sbjct: 131 ITVFQVLTQEDWNTV--LYNGMTKTSNWASLYFVALMTFGNYVLFNLLVAILVEGFSTED 188 Query: 193 LSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMAS 321 KK+ K++E+E +K D + +EEKE+ E ++E S Sbjct: 189 EEKKKEKMKELEDVDK--EDEEEEEEKEKQRLAENNNIDESQS 229 >UniRef50_Q0UJJ7 Cluster: Putative uncharacterized protein; n=1; Phaeosphaeria nodorum|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 1202 Score = 35.9 bits (79), Expect = 0.42 Identities = 22/55 (40%), Positives = 31/55 (56%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 Q R KKE K R+I+A+EK +DA+L ++ A E K LEE ++ K K Sbjct: 599 QKRKEKKE-KQRQIKAEEKAKKDAELAAKEAELKAAEEKRLEEQRKKREEQRKKK 652 >UniRef50_UPI000023DAB0 Cluster: hypothetical protein FG00429.1; n=1; Gibberella zeae PH-1|Rep: hypothetical protein FG00429.1 - Gibberella zeae PH-1 Length = 90 Score = 35.5 bits (78), Expect = 0.56 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 3/50 (6%) Frame = +1 Query: 139 RWSFLTVGVLYGAFHQNRLS---KKEAKLREIEAKEKVIRDAKLKEEKER 279 RWS L +G+ YG HQ ++ + E E E KE +I+ AK + K++ Sbjct: 10 RWSALGLGIFYGFTHQRAITASQRAEHAQHEYEKKENLIKQAKAEFAKKK 59 >UniRef50_Q0IA64 Cluster: Putative uncharacterized protein; n=9; Synechococcus|Rep: Putative uncharacterized protein - Synechococcus sp. (strain CC9311) Length = 244 Score = 35.5 bits (78), Expect = 0.56 Identities = 22/60 (36%), Positives = 34/60 (56%), Gaps = 2/60 (3%) Frame = -3 Query: 176 APYRTP--TVRKDQRPNLIRGDIRTGAPYGKSDILL*NCCTVKQLLYDTFWKNPIQYPEK 3 AP+R P V RP ++R +RT A YG ++ L N V++ +FW++P+ PEK Sbjct: 72 APHRHPFDIVLALPRPKMLRRILRTIAEYGVENLHLINSARVEK----SFWQSPLLTPEK 127 >UniRef50_Q556E8 Cluster: DNA ligase; n=2; Dictyostelium discoideum|Rep: DNA ligase - Dictyostelium discoideum AX4 Length = 1192 Score = 35.5 bits (78), Expect = 0.56 Identities = 18/38 (47%), Positives = 25/38 (65%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEE 312 KKE +L+E E KEK ++D K KE KE+ L+ K +E Sbjct: 253 KKEKELKEKELKEKELKDKKEKELKEKEKELKDKEKKE 290 Score = 33.9 bits (74), Expect = 1.7 Identities = 16/55 (29%), Positives = 33/55 (60%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 + L +KE +L++ E KEK +++ + KE++E+ + K +E+ K+ K+K Sbjct: 273 EKELKEKEKELKDKEKKEKELKEKEKKEKEEKEKEKKEKKEKELKEKEEKEKKEK 327 Score = 31.5 bits (68), Expect = 9.0 Identities = 20/51 (39%), Positives = 30/51 (58%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK 336 + + KKE +L+E E KEK ++ K KE KE+ L+ K L+E + KK Sbjct: 306 KEKKEKKEKELKEKEEKEKKEKELKEKELKEK--ELKEKELKEKELTSPKK 354 >UniRef50_Q18452 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 512 Score = 35.5 bits (78), Expect = 0.56 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = +1 Query: 175 AFHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKER 279 A H+ L KKE ++RE +AKEK + K EKER Sbjct: 264 AHHKEWLQKKEREIREKKAKEKAAAEQKAATEKER 298 >UniRef50_Q54J55 Cluster: Myb domain-containing protein; n=1; Dictyostelium discoideum AX4|Rep: Myb domain-containing protein - Dictyostelium discoideum AX4 Length = 1620 Score = 35.1 bits (77), Expect = 0.73 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDKI 351 +KE K +E++ KE ++ K K++KE+ E+K E+ K+ KDK+ Sbjct: 1066 EKEDKEKELKEKESKEKELKEKDDKEKEKEKELKEREDKEKEEDKEAKDKV 1116 >UniRef50_A2FV34 Cluster: Trichohyalin, putative; n=2; Eukaryota|Rep: Trichohyalin, putative - Trichomonas vaginalis G3 Length = 1071 Score = 35.1 bits (77), Expect = 0.73 Identities = 21/38 (55%), Positives = 25/38 (65%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEE 312 +KE + E E KEK R+AK KEEKE+A EIK EE Sbjct: 641 QKEKERIERERKEKEAREAKEKEEKEKAER-EIKEKEE 677 Score = 31.9 bits (69), Expect = 6.8 Identities = 18/55 (32%), Positives = 29/55 (52%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 + + KKE + +E E KEK R+ K K EKE+ E + +E +K K++ Sbjct: 408 KEKKEKKERERKEKEEKEKKEREEKEKTEKEKKEREEKERIERERKEKERKEKEE 462 Score = 31.9 bits (69), Expect = 6.8 Identities = 19/55 (34%), Positives = 29/55 (52%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 + RL ++ + RE E KEK+ R+ K KEE+E E K E ++ K+K Sbjct: 544 RERLEREAKEKREKEEKEKIERERKEKEEREAREKAE-KEKREREEKAERERKEK 597 Score = 31.9 bits (69), Expect = 6.8 Identities = 17/42 (40%), Positives = 24/42 (57%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALE 309 + R K+ + +E E KEK R+ K KEE+ER E + LE Sbjct: 649 RERKEKEAREAKEKEEKEKAEREIKEKEERERKQKEEKERLE 690 >UniRef50_A7EPB7 Cluster: Putative uncharacterized protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Putative uncharacterized protein - Sclerotinia sclerotiorum 1980 Length = 830 Score = 35.1 bits (77), Expect = 0.73 Identities = 18/42 (42%), Positives = 28/42 (66%), Gaps = 2/42 (4%) Frame = +1 Query: 193 LSKKEAKLREIEAKEKV--IRDAKLKEEKERASALEIKALEE 312 ++K+EAK RE KE IR+ KLKEE+E+A+ + + E+ Sbjct: 432 IAKREAKAREEREKEVAAQIREVKLKEEREKAAEIAAQMRED 473 >UniRef50_UPI00015C4450 Cluster: lipoprotein, putative; n=1; Streptococcus gordonii str. Challis substr. CH1|Rep: lipoprotein, putative - Streptococcus gordonii str. Challis substr. CH1 Length = 214 Score = 34.7 bits (76), Expect = 0.97 Identities = 18/51 (35%), Positives = 31/51 (60%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK 336 + + +++E KLRE E ++K + K +EE+ER A E K + E A T ++ Sbjct: 64 KEKKTEEERKLREEEERKKQEEERKAREEQERRDA-EAKQIAEQAEATVQQ 113 >UniRef50_Q23JX3 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 851 Score = 34.3 bits (75), Expect = 1.3 Identities = 20/57 (35%), Positives = 34/57 (59%), Gaps = 3/57 (5%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEK---ERASALEIKALEEMASGTAKK*KD 345 +N +++K+ L+++ + K++ D K++ E ER +A EIK LEE A G KD Sbjct: 156 KNEITEKQMLLQKLIKENKLLEDIKIQNEAILAEREAAQEIKDLEEEAIGLRGLLKD 212 >UniRef50_A4R849 Cluster: Predicted protein; n=1; Magnaporthe grisea|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 399 Score = 34.3 bits (75), Expect = 1.3 Identities = 18/41 (43%), Positives = 30/41 (73%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMAS 321 KK+AK+ E +A +K ++AK+KE+KE+ +A + K EE A+ Sbjct: 285 KKKAKM-EKQAAKKAAKEAKMKEKKEKKAAEKKKKEEEKAA 324 >UniRef50_A3GH16 Cluster: Predicted protein; n=2; Pichia stipitis|Rep: Predicted protein - Pichia stipitis (Yeast) Length = 600 Score = 34.3 bits (75), Expect = 1.3 Identities = 19/42 (45%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = +1 Query: 196 SKKEAKLREIEAKEKVIRDAKLKEEKERASAL-EIKALEEMA 318 SK+E + +E E KEK ++AK +EKE SA E++ +EE A Sbjct: 166 SKREQEAKEKEKKEKEAKEAKELKEKESVSASGELQEIEESA 207 >UniRef50_Q95L36 Cluster: Smooth muscle caldesmon protein; n=1; Oryctolagus cuniculus|Rep: Smooth muscle caldesmon protein - Oryctolagus cuniculus (Rabbit) Length = 268 Score = 33.9 bits (74), Expect = 1.7 Identities = 18/50 (36%), Positives = 29/50 (58%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 ++ + E E +EK R+ + KEE+ER E +A +E A+G K K+K Sbjct: 137 RERREKEERERREKEERERREKEERERIKEEERRAAKEAATGQGKGRKEK 186 >UniRef50_UPI000023ECEF Cluster: hypothetical protein FG05106.1; n=1; Gibberella zeae PH-1|Rep: hypothetical protein FG05106.1 - Gibberella zeae PH-1 Length = 1261 Score = 33.5 bits (73), Expect = 2.2 Identities = 18/44 (40%), Positives = 27/44 (61%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEM 315 Q + ++A+ R +AK K RDAK K E+ERA+ E K +E+ Sbjct: 879 QKKAQDEQAQRRR-DAKAKAERDAKAKSERERAALKEEKKKQEL 921 >UniRef50_A2E7B0 Cluster: Putative uncharacterized protein; n=5; Eukaryota|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 2240 Score = 33.5 bits (73), Expect = 2.2 Identities = 19/49 (38%), Positives = 28/49 (57%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTA 330 +NRL+ E KL E+E KE+ + KEEK + E K E+ +GT+ Sbjct: 1455 KNRLNDSEKKLEEVEKKEETKSEEPKKEEKPKKDK-ESKKEEKPNNGTS 1502 >UniRef50_A6SBI4 Cluster: Putative uncharacterized protein; n=1; Botryotinia fuckeliana B05.10|Rep: Putative uncharacterized protein - Botryotinia fuckeliana B05.10 Length = 940 Score = 33.5 bits (73), Expect = 2.2 Identities = 20/42 (47%), Positives = 29/42 (69%), Gaps = 4/42 (9%) Frame = +1 Query: 196 SKKEAKLREIEAKEKV--IRDAKLKEEKERAS--ALEIKALE 309 +K+EAK RE KE IR+ KLKEE+E+A+ A +I+ L+ Sbjct: 492 AKREAKAREEREKEVAAQIREVKLKEEREKAAEVAAQIRELK 533 Score = 32.3 bits (70), Expect = 5.2 Identities = 21/55 (38%), Positives = 31/55 (56%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 + + +++ KLR +EA +V D K + +KERA A E KA E A AK +K Sbjct: 423 EEAIKREQEKLR-LEAIARVEADKKARADKERAEA-EAKAKAEKAEAEAKAKAEK 475 Score = 31.9 bits (69), Expect = 6.8 Identities = 17/55 (30%), Positives = 31/55 (56%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 + R E +LRE+ AKE + R A+ K++++ A E K EE + K+ +++ Sbjct: 246 KKRKEDLEKRLRELRAKEALERAAREKKQRDEREAREQKEREEREAKERKEAEER 300 >UniRef50_P29720 Cluster: Treponemal membrane protein B precursor; n=1; Treponema phagedenis|Rep: Treponemal membrane protein B precursor - Treponema phagedenis Length = 384 Score = 33.5 bits (73), Expect = 2.2 Identities = 18/45 (40%), Positives = 23/45 (51%) Frame = +1 Query: 202 KEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK 336 KE RE+ AKEK +D KEE R +A E A + A+K Sbjct: 214 KEKAAREMAAKEKAAKDKAAKEEAARKAAEEAAARKAAEEAAARK 258 >UniRef50_P05661 Cluster: Myosin heavy chain, muscle; n=90; Bilateria|Rep: Myosin heavy chain, muscle - Drosophila melanogaster (Fruit fly) Length = 1962 Score = 33.5 bits (73), Expect = 2.2 Identities = 16/45 (35%), Positives = 29/45 (64%), Gaps = 1/45 (2%) Frame = +1 Query: 181 HQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERAS-ALEIKALEE 312 HQ ++ + +A++ E+E + + R A+ K EK+RA A E++ L E Sbjct: 1103 HQRQIKELQARIEELEEEVEAERQARAKAEKQRADLARELEELGE 1147 >UniRef50_O04096 Cluster: F-box protein At1g10890; n=8; core eudicotyledons|Rep: F-box protein At1g10890 - Arabidopsis thaliana (Mouse-ear cress) Length = 592 Score = 33.5 bits (73), Expect = 2.2 Identities = 19/38 (50%), Positives = 26/38 (68%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEE 312 +KEA L IEAKEK R+ + KEE+ER + +K +EE Sbjct: 133 EKEASL--IEAKEKEEREQQEKEERERIAEENLKRVEE 168 >UniRef50_Q4S3B9 Cluster: Chromosome 1 SCAF14751, whole genome shotgun sequence; n=3; Clupeocephala|Rep: Chromosome 1 SCAF14751, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 362 Score = 33.1 bits (72), Expect = 3.0 Identities = 15/53 (28%), Positives = 28/53 (52%) Frame = +3 Query: 36 SIVQ*LFYSTAIL*QNVRFTIRSTCAYIASNQVWTLVLPHRRSSIRRLPPEQA 194 S+ + FY+ ++L +F + + C N + VLPHR + ++ L P Q+ Sbjct: 94 SVARQRFYAPSLLSSETQFLVSAGCENGFQNSSGSSVLPHRAAGLKSLGPRQS 146 >UniRef50_Q4RQT6 Cluster: Chromosome 2 SCAF15004, whole genome shotgun sequence; n=3; Deuterostomia|Rep: Chromosome 2 SCAF15004, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1605 Score = 33.1 bits (72), Expect = 3.0 Identities = 18/38 (47%), Positives = 25/38 (65%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEE 312 + E ++++ E KE+V R+ K KEEKER EIK EE Sbjct: 973 RMEREIKDKEEKERVERELKEKEEKERMER-EIKEKEE 1009 Score = 32.7 bits (71), Expect = 3.9 Identities = 18/36 (50%), Positives = 24/36 (66%) Frame = +1 Query: 205 EAKLREIEAKEKVIRDAKLKEEKERASALEIKALEE 312 E +L+E E KE++ R+ K KEEKER E+K EE Sbjct: 988 ERELKEKEEKERMEREIKEKEEKERMQR-ELKEREE 1022 Score = 32.3 bits (70), Expect = 5.2 Identities = 18/36 (50%), Positives = 24/36 (66%) Frame = +1 Query: 205 EAKLREIEAKEKVIRDAKLKEEKERASALEIKALEE 312 E +L+E E KE++ R+ K KEEKER E+K EE Sbjct: 962 ERELKEKEDKERMEREIKDKEEKERVER-ELKEKEE 996 Score = 32.3 bits (70), Expect = 5.2 Identities = 16/36 (44%), Positives = 26/36 (72%) Frame = +1 Query: 205 EAKLREIEAKEKVIRDAKLKEEKERASALEIKALEE 312 E++L+E + KE++ R+ K KEE+ER +E+K EE Sbjct: 1027 ESELKEKKEKERIERERKEKEEEER-MVMELKEKEE 1061 Score = 31.9 bits (69), Expect = 6.8 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKER 279 K E + RE E KE+V R+ K KEEKER Sbjct: 882 KMEREQREKEEKERVERELKEKEEKER 908 Score = 31.9 bits (69), Expect = 6.8 Identities = 18/36 (50%), Positives = 24/36 (66%) Frame = +1 Query: 205 EAKLREIEAKEKVIRDAKLKEEKERASALEIKALEE 312 E +L+E E KE++ R+ K KEEKER E+K EE Sbjct: 897 ERELKEKEEKERMEREHKDKEEKERIQR-ELKEKEE 931 >UniRef50_Q5CHL0 Cluster: Garp protein; n=3; Cryptosporidium|Rep: Garp protein - Cryptosporidium hominis Length = 789 Score = 33.1 bits (72), Expect = 3.0 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +1 Query: 190 RLSKKEAKLREIEAKEKVIRDAK-LKEEKERASALEIKALEEMASGTAKK*KDK 348 +L KKE +L++ + KE++ D K K+EKE LEI+ +++ + K K K Sbjct: 217 KLEKKEKELKKQKEKERLKLDKKEKKKEKEEKKRLEIEKKKQLKNEKKNKNKSK 270 >UniRef50_Q23DV1 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 1343 Score = 33.1 bits (72), Expect = 3.0 Identities = 17/54 (31%), Positives = 30/54 (55%) Frame = +1 Query: 175 AFHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK 336 A + + ++E KL+E + K+K + +LK++KE E + LEE A+K Sbjct: 940 ALKEKKKREEEEKLKEQQEKQKKEHELQLKKQKEEEEQKEKQRLEEERKRAAQK 993 >UniRef50_Q6FNW3 Cluster: Candida glabrata strain CBS138 chromosome J complete sequence; n=1; Candida glabrata|Rep: Candida glabrata strain CBS138 chromosome J complete sequence - Candida glabrata (Yeast) (Torulopsis glabrata) Length = 1196 Score = 33.1 bits (72), Expect = 3.0 Identities = 23/55 (41%), Positives = 34/55 (61%), Gaps = 3/55 (5%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKL-KEEKERASA--LEIKALEEMASGTAKK*KDKIV 354 K++AKL E K K++ D KL KEEK++ LEIK +EEM + K D+++ Sbjct: 825 KRKAKLDE---KRKLLTDGKLSKEEKQKLEEEELEIKEIEEMHNNKRKLSLDQLL 876 >UniRef50_Q6CGN4 Cluster: Similarity; n=4; Eukaryota|Rep: Similarity - Yarrowia lipolytica (Candida lipolytica) Length = 1268 Score = 33.1 bits (72), Expect = 3.0 Identities = 15/38 (39%), Positives = 26/38 (68%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEE 312 ++EAKL E++ KE+ + + K+++E A LE+K EE Sbjct: 683 EEEAKLLELKKKEEAKKKEEAKKKEEEAKLLELKKKEE 720 Score = 32.7 bits (71), Expect = 3.9 Identities = 22/50 (44%), Positives = 31/50 (62%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 K+EAKL++ EAKEK ++A K E E ++ KA + A G+AK DK Sbjct: 731 KEEAKLKDAEAKEKAAKEAAKKLEVE----IKEKA-AQAAKGSAKAEADK 775 >UniRef50_A4RP63 Cluster: Putative uncharacterized protein; n=1; Magnaporthe grisea|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 827 Score = 33.1 bits (72), Expect = 3.0 Identities = 21/51 (41%), Positives = 35/51 (68%), Gaps = 1/51 (1%) Frame = +1 Query: 199 KKEAKLRE-IEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 KKE +LRE +E KE+ +R+ + KE++ER E++A +E+A AK+ +K Sbjct: 348 KKERELREALEKKEQELRELREKEQRER-ELRELRA-KELAERLAKERLEK 396 >UniRef50_Q8ILS1 Cluster: Putative uncharacterized protein; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 838 Score = 32.7 bits (71), Expect = 3.9 Identities = 19/38 (50%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = +1 Query: 199 KKEAKLREIEAKE-KVIRDAKLKEEKERASALEIKALE 309 +KE K+ EI+ KE KVI KLKEEK+ S ++ K E Sbjct: 16 EKEQKINEIKMKELKVIEKIKLKEEKKIKSIMKRKVDE 53 >UniRef50_Q5C690 Cluster: SJCHGC04883 protein; n=1; Schistosoma japonicum|Rep: SJCHGC04883 protein - Schistosoma japonicum (Blood fluke) Length = 230 Score = 32.7 bits (71), Expect = 3.9 Identities = 15/51 (29%), Positives = 31/51 (60%) Frame = +1 Query: 169 YGAFHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMAS 321 Y A+ + + + A++R+ E + + I + + KE+ R SALE +A E+++ Sbjct: 70 YAAYIEAQQQAEMARMRQQEERRRKIEEMRQKEQTRRLSALERRAALELSN 120 >UniRef50_A2EUZ9 Cluster: Kelch motif family protein; n=1; Trichomonas vaginalis G3|Rep: Kelch motif family protein - Trichomonas vaginalis G3 Length = 1419 Score = 32.7 bits (71), Expect = 3.9 Identities = 21/58 (36%), Positives = 34/58 (58%) Frame = +1 Query: 175 AFHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 A + + ++ + E E K+K + KLKEE+ER +A E KA EE A AK+ +++ Sbjct: 906 AERKQKEEEERKQKEEEERKQKEEEERKLKEEQERKAAEEKKAKEE-AERKAKEEQER 962 >UniRef50_Q7S2K6 Cluster: Predicted protein; n=3; Sordariomycetes|Rep: Predicted protein - Neurospora crassa Length = 99 Score = 32.7 bits (71), Expect = 3.9 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Frame = +1 Query: 139 RWSFLTVGVLYGAFHQNRLS---KKEAKLREIEAKEKVIRDAK 258 R+S L G+ YG HQ +S K A RE E K+++I AK Sbjct: 14 RYSALAAGIFYGFTHQRSISAAEKAAAAQREYEHKQELINKAK 56 >UniRef50_Q2HAW1 Cluster: Putative uncharacterized protein; n=1; Chaetomium globosum|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 695 Score = 32.7 bits (71), Expect = 3.9 Identities = 21/48 (43%), Positives = 26/48 (54%) Frame = +1 Query: 211 KLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDKIV 354 K E EAK K +A+ K E ER +A E KA EE K KDK++ Sbjct: 415 KQLEAEAKLKAEVEAREKLEAERKAAEEAKAAEEQRKKDEKIYKDKLL 462 >UniRef50_Q2GSB9 Cluster: Putative uncharacterized protein; n=1; Chaetomium globosum|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 635 Score = 32.7 bits (71), Expect = 3.9 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = +1 Query: 190 RLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK 336 R KKE +L+E E K + + AK +EEK++ E + +E G K+ Sbjct: 453 RKEKKEKELKEAEEKREAEKKAKEEEEKKKEEEEEKEKKKEKKGGKKKR 501 >UniRef50_A2R8W1 Cluster: Contig An16c0270, complete genome; n=2; Trichocomaceae|Rep: Contig An16c0270, complete genome - Aspergillus niger Length = 92 Score = 32.7 bits (71), Expect = 3.9 Identities = 18/51 (35%), Positives = 32/51 (62%), Gaps = 3/51 (5%) Frame = +1 Query: 139 RWSFLTVGVLYGAFHQNRL--SKKEAKL-REIEAKEKVIRDAKLKEEKERA 282 R+S L G++YG +HQ+ + + K A+ RE +E++I AK + +K+ A Sbjct: 11 RYSALVAGLVYGFYHQSSITATAKHAEAEREYARQERLIEQAKAEWKKKTA 61 >UniRef50_UPI0000DB7211 Cluster: PREDICTED: similar to Stretchin-Mlck CG18255-PA, isoform A; n=2; Coelomata|Rep: PREDICTED: similar to Stretchin-Mlck CG18255-PA, isoform A - Apis mellifera Length = 3978 Score = 32.3 bits (70), Expect = 5.2 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +1 Query: 184 QNRLSKKEA-KLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDKI 351 + R K+EA KL++ E ++K KLK+EKER E K L++ K+ +K+ Sbjct: 2888 KERKKKEEAEKLKQEEEQKKKEEAEKLKQEKERKKKEEAKKLKQEEERKKKEEAEKL 2944 >UniRef50_Q5R1T0 Cluster: Chromatin assembly factor-1p150; n=6; Amniota|Rep: Chromatin assembly factor-1p150 - Gallus gallus (Chicken) Length = 937 Score = 32.3 bits (70), Expect = 5.2 Identities = 16/33 (48%), Positives = 21/33 (63%) Frame = +1 Query: 202 KEAKLREIEAKEKVIRDAKLKEEKERASALEIK 300 K+ K E E KE+ R+ K KEEKE+A L +K Sbjct: 349 KKKKEEEKELKERERREKKEKEEKEKAEKLRVK 381 >UniRef50_A5I4E1 Cluster: Hypothetical phage protein; n=1; Clostridium botulinum A str. ATCC 3502|Rep: Hypothetical phage protein - Clostridium botulinum A str. ATCC 3502 Length = 256 Score = 32.3 bits (70), Expect = 5.2 Identities = 15/41 (36%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = +1 Query: 187 NRLSKKEAKLREIEAKEKVIR-DAKLKEEKERASALEIKAL 306 N K A+++EIE EK+I+ D ++KE+K + S L++ ++ Sbjct: 168 NSNGKLAAEVKEIEKAEKIIKEDKEVKEDKSKGSKLKVLSM 208 >UniRef50_A3VQ48 Cluster: Sensor protein; n=1; Parvularcula bermudensis HTCC2503|Rep: Sensor protein - Parvularcula bermudensis HTCC2503 Length = 462 Score = 32.3 bits (70), Expect = 5.2 Identities = 13/41 (31%), Positives = 25/41 (60%) Frame = +1 Query: 94 PYGAPVRISPLIKFGRWSFLTVGVLYGAFHQNRLSKKEAKL 216 P P + SPLI+ G W+ L +GV++ A + +++ + +L Sbjct: 165 PLPGPEQASPLIELGSWAALLLGVVFTAAYARQVAISQRRL 205 >UniRef50_Q9MAA8 Cluster: T12H1.7 protein; n=1; Arabidopsis thaliana|Rep: T12H1.7 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 372 Score = 32.3 bits (70), Expect = 5.2 Identities = 17/37 (45%), Positives = 24/37 (64%) Frame = +1 Query: 190 RLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIK 300 +L +E +LRE+EAK K D K KE +E+ LE+K Sbjct: 68 QLEARENELREVEAKRKFF-DLKEKELEEKEKELELK 103 >UniRef50_Q7XT54 Cluster: OSJNBa0010D21.8 protein; n=5; Oryza sativa|Rep: OSJNBa0010D21.8 protein - Oryza sativa subsp. japonica (Rice) Length = 653 Score = 32.3 bits (70), Expect = 5.2 Identities = 16/38 (42%), Positives = 24/38 (63%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEE 312 KKE K REIE K++ + K ++E +A E+K LE+ Sbjct: 305 KKEKKAREIEEKKQKRLETKKQKEAMKAELAELKKLEK 342 >UniRef50_Q2TA33 Cluster: LOC616002 protein; n=3; Bos taurus|Rep: LOC616002 protein - Bos taurus (Bovine) Length = 397 Score = 32.3 bits (70), Expect = 5.2 Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Frame = +1 Query: 166 LYGAFHQNRLSKKEAKLREIEAKEKVIRDAKLKE-EKERASALEIKALEEMASGTAKK*K 342 LY + +K+ K + E KEK +RD K +E EKE E K EE K+ K Sbjct: 322 LYRCLFSEKKEEKDMKEKAKEVKEKEVRDVKEEEREKEEKQRKEEKEKEEKKEKERKE-K 380 Query: 343 DK 348 +K Sbjct: 381 EK 382 >UniRef50_A5E1H8 Cluster: Putative uncharacterized protein; n=1; Lodderomyces elongisporus NRRL YB-4239|Rep: Putative uncharacterized protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 728 Score = 32.3 bits (70), Expect = 5.2 Identities = 17/37 (45%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = +1 Query: 202 KEAKLREIEAKEKVIRDAKLKE-EKERASALEIKALE 309 KEA+ RE EA+E R+A++KE E A A E +A++ Sbjct: 617 KEAEAREAEAREAEAREAEIKEAEAREAEAREAEAIK 653 >UniRef50_UPI000155C1F8 Cluster: PREDICTED: hypothetical protein; n=1; Ornithorhynchus anatinus|Rep: PREDICTED: hypothetical protein - Ornithorhynchus anatinus Length = 668 Score = 31.9 bits (69), Expect = 6.8 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +1 Query: 184 QNRLSKKEAKLREIEA-KEKVIRDAKLKEEKERASALEIKAL 306 Q + KKEAKL+EIEA E+ I K ++ER+S LE + + Sbjct: 416 QKTIEKKEAKLKEIEAILEEEITPTLHKLKEERSSYLEYQKI 457 >UniRef50_UPI000023D4D6 Cluster: hypothetical protein FG11138.1; n=1; Gibberella zeae PH-1|Rep: hypothetical protein FG11138.1 - Gibberella zeae PH-1 Length = 473 Score = 31.9 bits (69), Expect = 6.8 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 4/49 (8%) Frame = -3 Query: 221 SRSFASF-FDSLFWWKAPYR---TPTVRKDQRPNLIRGDIRTGAPYGKS 87 SR F S FDSL+WW+ Y +P P+ ++ D+ G+ Y S Sbjct: 394 SRLFMSVVFDSLWWWRVEYNGQGSPYDMDKTAPDAVQADMEGGSTYWNS 442 >UniRef50_Q4S8N4 Cluster: Chromosome 7 SCAF14703, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 7 SCAF14703, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 168 Score = 31.9 bits (69), Expect = 6.8 Identities = 15/35 (42%), Positives = 24/35 (68%) Frame = +1 Query: 214 LREIEAKEKVIRDAKLKEEKERASALEIKALEEMA 318 +++ + KEK + KE+KER S E+K+LEEM+ Sbjct: 6 IKKDKEKEKDLGKKDKKEKKERMSQAELKSLEEMS 40 >UniRef50_Q1DBV7 Cluster: TldD/PmbA family protein; n=1; Myxococcus xanthus DK 1622|Rep: TldD/PmbA family protein - Myxococcus xanthus (strain DK 1622) Length = 444 Score = 31.9 bits (69), Expect = 6.8 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = +1 Query: 214 LREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAK 333 LRE+E + DA +E+ +R + LE+KA + +G A+ Sbjct: 125 LREVERRTLSASDAHQREDHQRHALLEVKAFHDTGAGMAE 164 >UniRef50_A6QAG2 Cluster: Oxidoreductase; n=2; Sulfurovum sp. NBC37-1|Rep: Oxidoreductase - Sulfurovum sp. (strain NBC37-1) Length = 433 Score = 31.9 bits (69), Expect = 6.8 Identities = 20/60 (33%), Positives = 29/60 (48%) Frame = +1 Query: 19 IGFFQKVSYNNCFTVQQFYNKMSDLPYGAPVRISPLIKFGRWSFLTVGVLYGAFHQNRLS 198 IG + ++ NN FT QF G ++ + G+ SFL V LYG ++N LS Sbjct: 292 IGHWNRIYGNNGFTQYQFILPKETSYEGLEEILTAISNSGKGSFLAVLKLYGKANENWLS 351 >UniRef50_A5FBV3 Cluster: Mammalian cell entry related domain protein; n=1; Flavobacterium johnsoniae UW101|Rep: Mammalian cell entry related domain protein - Flavobacterium johnsoniae UW101 Length = 279 Score = 31.9 bits (69), Expect = 6.8 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKERASALEIK 300 +K AK +E +AKE+ + K KEEKE+ A E K Sbjct: 240 EKAAKEKEAKAKEEKEKQEKAKEEKEKQKAEEAK 273 >UniRef50_A3NLV7 Cluster: Putative uncharacterized protein; n=1; Burkholderia pseudomallei 668|Rep: Putative uncharacterized protein - Burkholderia pseudomallei (strain 668) Length = 106 Score = 31.9 bits (69), Expect = 6.8 Identities = 23/77 (29%), Positives = 38/77 (49%), Gaps = 2/77 (2%) Frame = +1 Query: 124 LIKFGRWSFLTVGVLYGAF-HQN-RLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEI 297 L+KFG W GVL+G F HQ R + +A + EA+ A +E+ +++ E Sbjct: 7 LLKFGPWLLAVAGVLFGMFRHQQARTATAQAGQKTAEAQATA---AAAREQVAQSANAEA 63 Query: 298 KALEEMASGTAKK*KDK 348 +A + A A K++ Sbjct: 64 QANADAAQAGAAAAKER 80 >UniRef50_A0L961 Cluster: Sel1 domain protein repeat-containing protein precursor; n=4; cellular organisms|Rep: Sel1 domain protein repeat-containing protein precursor - Magnetococcus sp. (strain MC-1) Length = 831 Score = 31.9 bits (69), Expect = 6.8 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 5/50 (10%) Frame = +1 Query: 175 AFHQNRLSKKEAKLREI-----EAKEKVIRDAKLKEEKERASALEIKALE 309 A Q R+ ++E +L I EA+++ A++KEE+ER + + +KA E Sbjct: 175 AAEQARVKEEEERLTRIRVKAQEAEQRAAEQARVKEEEERLTRIRVKAQE 224 >UniRef50_Q9VYU0 Cluster: CG32662-PA; n=2; Drosophila melanogaster|Rep: CG32662-PA - Drosophila melanogaster (Fruit fly) Length = 1168 Score = 31.9 bits (69), Expect = 6.8 Identities = 18/38 (47%), Positives = 28/38 (73%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEE 312 K++AK +E++ KEK R+AKL +EKE+ L++K EE Sbjct: 459 KEKAKEKELKLKEKE-REAKL-QEKEKEEKLKLKEREE 494 >UniRef50_Q54UA6 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 449 Score = 31.9 bits (69), Expect = 6.8 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Frame = +1 Query: 196 SKKEAKLREIEAKEKVIRDAKLKEEKER-ASALEIKALEEMASGTAKK*KDK 348 ++ ++ L+E E KEK ++ K KE KE+ A E K E + T +K K K Sbjct: 208 TRSKSSLKENETKEKETKETKEKEAKEKEAKEKEAKEKETKENETKEKPKGK 259 >UniRef50_Q4UGF8 Cluster: Dead/deah box RNA helicase, putative; n=3; Theileria|Rep: Dead/deah box RNA helicase, putative - Theileria annulata Length = 988 Score = 31.9 bits (69), Expect = 6.8 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEE 312 K +R+IE ++I K+K+ ERA L +K+L+E Sbjct: 292 KNNPLMRKIEHSNQIISSKKIKKLAERAGTLNVKSLKE 329 >UniRef50_O44991 Cluster: Lipid depleted protein 6; n=5; Bilateria|Rep: Lipid depleted protein 6 - Caenorhabditis elegans Length = 573 Score = 31.9 bits (69), Expect = 6.8 Identities = 15/41 (36%), Positives = 27/41 (65%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMAS 321 K+ K RE E++++VIR + +E++ A E+KA+ E A+ Sbjct: 352 KQMKKRREQESEQRVIRRLTIVKEQQDAEEAEVKAIRENAA 392 >UniRef50_Q6C373 Cluster: Similarity; n=1; Yarrowia lipolytica|Rep: Similarity - Yarrowia lipolytica (Candida lipolytica) Length = 704 Score = 31.9 bits (69), Expect = 6.8 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEE 312 + RL +++ K++E +A+ K + K KEEKE+ A K EE Sbjct: 280 KQRLREEKQKIKEEKARIKAEKALKHKEEKEKRDAERFKLAEE 322 >UniRef50_Q12263 Cluster: Serine/threonine-protein kinase GIN4; n=4; Eukaryota|Rep: Serine/threonine-protein kinase GIN4 - Saccharomyces cerevisiae (Baker's yeast) Length = 1142 Score = 31.9 bits (69), Expect = 6.8 Identities = 18/43 (41%), Positives = 27/43 (62%), Gaps = 2/43 (4%) Frame = +1 Query: 169 YGAFHQNRLSKKEA--KLREIEAKEKVIRDAKLKEEKERASAL 291 Y + Q R K+E K+RE +A+E++ R + +EEKERA L Sbjct: 553 YEKYEQIRKEKEELERKVREAKAREELERRRRKQEEKERARKL 595 >UniRef50_UPI0000E46A9B Cluster: PREDICTED: similar to MGC68765 protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to MGC68765 protein - Strongylocentrotus purpuratus Length = 674 Score = 31.5 bits (68), Expect = 9.0 Identities = 18/50 (36%), Positives = 29/50 (58%) Frame = +1 Query: 199 KKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 KKE + +EIE KEK ++ K KE+KE+ + + +++ KK K K Sbjct: 55 KKEKEKKEIEKKEKKEKEKKEKEKKEKEKKEKKEKVKKDKKTKDKKEKKK 104 >UniRef50_UPI0000DB6B60 Cluster: PREDICTED: hypothetical protein; n=2; Apis mellifera|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 1633 Score = 31.5 bits (68), Expect = 9.0 Identities = 14/36 (38%), Positives = 25/36 (69%) Frame = +1 Query: 202 KEAKLREIEAKEKVIRDAKLKEEKERASALEIKALE 309 KE++++E E KE I++ +++E+K + LEIK E Sbjct: 1136 KESEIKEPEIKESEIKEPEIQEQKIKEIELEIKESE 1171 >UniRef50_UPI00006CD0F6 Cluster: Protein kinase domain containing protein; n=1; Tetrahymena thermophila SB210|Rep: Protein kinase domain containing protein - Tetrahymena thermophila SB210 Length = 1504 Score = 31.5 bits (68), Expect = 9.0 Identities = 20/52 (38%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = +1 Query: 184 QNRLSKKEAKLREIE-AKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK 336 QN+ ++E +L+EIE K+K ++D ++E ER ++K LEE AKK Sbjct: 1032 QNKQREEEKRLQEIEKQKKKELQDLMKQKELERQ---KLKELEEKEKELAKK 1080 >UniRef50_Q4RZS5 Cluster: Chromosome 18 SCAF14786, whole genome shotgun sequence; n=3; Tetraodontidae|Rep: Chromosome 18 SCAF14786, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1966 Score = 31.5 bits (68), Expect = 9.0 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 2/53 (3%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIK--ALEEMASGTAKK 336 + +L ++EA ++++ EKV D+K+KE +ER LE + L + ASG +K Sbjct: 1032 EQQLDEEEAARQKLQI-EKVTTDSKIKEHEERILMLEDQNNKLNKTASGKRRK 1083 >UniRef50_Q2B5K8 Cluster: Putative uncharacterized protein; n=1; Bacillus sp. NRRL B-14911|Rep: Putative uncharacterized protein - Bacillus sp. NRRL B-14911 Length = 372 Score = 31.5 bits (68), Expect = 9.0 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = +1 Query: 193 LSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMA-SGTAKK*KDK 348 L+ + K EIE K+++ + KEE R A IK +E SG+A K KDK Sbjct: 214 LTAGKFKEEEIERKQQLEEREREKEEAAREKAESIKRKQEQQNSGSADKAKDK 266 >UniRef50_Q04UH0 Cluster: Endoflagellar hook-length control protein; n=4; Leptospira|Rep: Endoflagellar hook-length control protein - Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) Length = 518 Score = 31.5 bits (68), Expect = 9.0 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK 336 Q+R SKKE+ +RE+E+K + ++K+ E + + IK +E G + K Sbjct: 201 QSRTSKKESLVREVESK---LSESKVVSEISKFNETGIKEFQENGKGFSNK 248 >UniRef50_A4EEC0 Cluster: Putative uncharacterized protein; n=1; Roseobacter sp. CCS2|Rep: Putative uncharacterized protein - Roseobacter sp. CCS2 Length = 746 Score = 31.5 bits (68), Expect = 9.0 Identities = 30/112 (26%), Positives = 48/112 (42%), Gaps = 12/112 (10%) Frame = +1 Query: 22 GFFQKVSYNNCFT--VQQFYNKMSDLPYGAPVRISPLIKFGRWSFLTVGVLYG--AFHQN 189 GF Q N + + Q + DLPY PVR+ G+ L + +L AF Sbjct: 196 GFVQGADLNEWYEKKLTQEQRRFVDLPYDGPVRLRGAAGTGKTLALVIKMLMDSLAFENG 255 Query: 190 R-------LSKKEAKLREIEA-KEKVIRDAKLKEEKERASALEIKALEEMAS 321 + +A + I+A E +I AKL+E +EI+ L ++A+ Sbjct: 256 NEPFRLCFVVHSQASVDLIQAISESLISQAKLREFTSGGGRIEIRTLYDLAN 307 >UniRef50_A2XRS1 Cluster: Putative uncharacterized protein; n=1; Oryza sativa (indica cultivar-group)|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 265 Score = 31.5 bits (68), Expect = 9.0 Identities = 15/34 (44%), Positives = 24/34 (70%) Frame = +1 Query: 205 EAKLREIEAKEKVIRDAKLKEEKERASALEIKAL 306 EAK R+ E +K++ +L+E++ER S LEI A+ Sbjct: 16 EAKRRQEEKIDKLLEMFELREKRERESMLEISAI 49 >UniRef50_Q5CRM2 Cluster: Putative uncharacterized protein; n=1; Cryptosporidium parvum Iowa II|Rep: Putative uncharacterized protein - Cryptosporidium parvum Iowa II Length = 307 Score = 31.5 bits (68), Expect = 9.0 Identities = 19/43 (44%), Positives = 26/43 (60%) Frame = +1 Query: 184 QNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEE 312 Q RL KK+AK E EAKE ++ LKEEK + S + K ++ Sbjct: 168 QERLQKKQAKEMENEAKENERKN--LKEEKSKESVEQNKVKKD 208 >UniRef50_Q227C1 Cluster: Putative uncharacterized protein; n=2; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 600 Score = 31.5 bits (68), Expect = 9.0 Identities = 14/34 (41%), Positives = 25/34 (73%) Frame = +1 Query: 178 FHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKER 279 + Q +L K++ KL+E + KE+ ++ KLKEE+E+ Sbjct: 74 YEQQKLEKQQKKLKEQQEKER--QEQKLKEEQEK 105 >UniRef50_A7T0N7 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 223 Score = 31.5 bits (68), Expect = 9.0 Identities = 18/57 (31%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Frame = +1 Query: 187 NRLSKKEAKL-REIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDKIV 354 ++LSK+EA+L + + K++ + L + ++R LEIK LEE + A+ +D ++ Sbjct: 12 SKLSKQEARLLKRVLEKQRYFEE--LTDRRKRYLKLEIKQLEERLANAARHVRDPLL 66 >UniRef50_Q5KHY3 Cluster: Putative uncharacterized protein; n=1; Filobasidiella neoformans|Rep: Putative uncharacterized protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 1353 Score = 31.5 bits (68), Expect = 9.0 Identities = 20/51 (39%), Positives = 31/51 (60%), Gaps = 1/51 (1%) Frame = +1 Query: 202 KEAKLREIEAKEKVIRDAKLKEEKERASALEI-KALEEMASGTAKK*KDKI 351 +E +L+E E KE+ I+ AK K EKER + + KA + + AK+ +KI Sbjct: 852 RENELKEKERKEREIKAAKEKAEKERIAKETLEKAERDRLAKEAKEKAEKI 902 >UniRef50_Q4PGQ7 Cluster: Putative uncharacterized protein; n=1; Ustilago maydis|Rep: Putative uncharacterized protein - Ustilago maydis (Smut fungus) Length = 1436 Score = 31.5 bits (68), Expect = 9.0 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +1 Query: 190 RLSKKEAKLREIEAKEKVIRDAKLKEEKERASA 288 + SKK+AK+ E EAK+K +AK K + ++ A Sbjct: 833 KASKKQAKIEEREAKKKAKAEAKAKAQADKQQA 865 >UniRef50_Q1MTN9 Cluster: Chromatin remodeling complex subunit Rlf2; n=3; Schizosaccharomyces pombe|Rep: Chromatin remodeling complex subunit Rlf2 - Schizosaccharomyces pombe (Fission yeast) Length = 544 Score = 31.5 bits (68), Expect = 9.0 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Frame = +1 Query: 202 KEAKLREIEAKEKVIRDA---KLKEEKERASALEIKALEEMASGTAKK*KD 345 KE KL++ A+E+ IR +LK EKER + K L E AKK K+ Sbjct: 76 KEKKLQKQRAQEERIRQKEAERLKREKERQQREQEKKLREQEKIAAKKMKE 126 >UniRef50_A4RJF9 Cluster: Putative uncharacterized protein; n=1; Magnaporthe grisea|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 1348 Score = 31.5 bits (68), Expect = 9.0 Identities = 17/46 (36%), Positives = 25/46 (54%) Frame = +1 Query: 175 AFHQNRLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEE 312 A Q KKEA+ RE EAK + + + K E+E+ LE + +E Sbjct: 947 ALEQAAARKKEAEEREAEAKRQAKLEKERKREREQQQRLEAERQKE 992 >UniRef50_A3LYI0 Cluster: Negative affector of Salt Tolerance; n=1; Pichia stipitis|Rep: Negative affector of Salt Tolerance - Pichia stipitis (Yeast) Length = 1234 Score = 31.5 bits (68), Expect = 9.0 Identities = 19/53 (35%), Positives = 28/53 (52%) Frame = +1 Query: 190 RLSKKEAKLREIEAKEKVIRDAKLKEEKERASALEIKALEEMASGTAKK*KDK 348 R K+EAKL+ E K+K I + K KEE+ + + EE A ++ K K Sbjct: 710 RRRKEEAKLKREEEKKKRIEELKRKEEEHKKKVEAQQKKEEEAKKLKEERKKK 762 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 413,274,081 Number of Sequences: 1657284 Number of extensions: 7090234 Number of successful extensions: 27144 Number of sequences better than 10.0: 88 Number of HSP's better than 10.0 without gapping: 24369 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26810 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 24351434270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -